[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64946.1"

            "indolepyruvate ferredoxin oxidoreductase alpha subunit part 2, authentic frameshift"
            ""

OrgPattern --2-12111111111111111111--------111---222221111112222-2222222-111--- ------------------------------------1------------------------------------------122------1111-111------------------------------1-11--11-------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2231-----------21------1-1---1-2---1121-2121-121---3--------------1---11111----------1----------1--------------------1-------1-------------1-1--------------------------------1-----------------------------------------------1-3---1----------------111-2411111111221-2321221211111--12---------------------11---------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDKWRELEKLSSDFLQIEGSGDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGISVPVPPK:Sequence : cEEEEEccTHHHHHHHHHHHHTccEEEEEEcEEEcccH :Sec Str : =======================================:RP:SCP|22->66|1dtwB2|4e-04|17.8|45/138|c.48.1.2 :========================================================== :BL:SWS|1->58,147->375|IORA_PYRAB|1e-47|48.0|282/648 61: . . . * . .: 120 :VREIARGGEVVVVEEGDPVVEIQLRALGINTRGKIDGYFPKHGELDINKTALGLAKALGL:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|67->81|ggevvvveegdpvve : XXXXXXXXXX:SEG|111->120|alglakalgl :====== :RP:SCP|22->66|1dtwB2|4e-04|17.8|45/138|c.48.1.2 121: . . + . . .: 180 :SYAPPTPLKPPLEPPPRPPVLCPGCPHMATFYILRLATAGLNPVWSGDIGCYSLGINTGQ:Sequence : cHTTTccHHHHHHHHHTcGGGGcccTTccccccc:Sec Str : XXXXXXXXXXXXXXXXXXXXXXX :SEG|124->146|pptplkppleppprppvlcpgcp : ==================================:BL:SWS|1->58,147->375|IORA_PYRAB|1e-47|48.0|282/648 181: . * . . . .: 240 :QDLITHMGSSVGLGAGIALATGQFVVATVGDSTFYHAVLPQLVDIATRSVPILIVVMDNA:Sequence :ccTTHHHHHHHHHHHHHHHTccccEEEEEETGGGGcHHHHHHHHHHHTTccEEEEEEEcc:Sec Str : =======================================================:RP:SCP|186->297|1ni4A|9e-12|22.0|109/362|c.36.1.11 :============================================================:BL:SWS|1->58,147->375|IORA_PYRAB|1e-47|48.0|282/648 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|187->251|PF02775|9e-06|42.9|63/139|TPP_enzyme_C 241: + . . . . *: 300 :YTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSVEIIKKAVEIVKSGRPAVVVS:Sequence :EETTEEGGGTcccccccGGGGGTTTccEEEEETTcHHHHHHHHHHHHHHHHTTcccEEEE:Sec Str :========================================================= :RP:SCP|186->297|1ni4A|9e-12|22.0|109/362|c.36.1.11 :============================================================:BL:SWS|1->58,147->375|IORA_PYRAB|1e-47|48.0|282/648 :$$$$$$$$$$$ :RP:PFM|187->251|PF02775|9e-06|42.9|63/139|TPP_enzyme_C 301: . . . . + .: 360 :RRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCV:Sequence :EEcccccccccccccGTTTcHHHHHHHHHHTTTcccTTcTTccEEEEccccEEEcTTTcc:Sec Str : ##:PROS|359->370|PS00198|4FE4S_FER_1|PDOC00176| : =====================================:RP:SCP|324->377|1durA|1e-11|34.6|52/55|d.58.1.1 :============================================================:BL:SWS|1->58,147->375|IORA_PYRAB|1e-47|48.0|282/648 : =======:BL:SWS|354->386|FER1_CAUCR|3e-04|42.4|33/113 361: . . . * . .: 420 :GCGICAEVCPFNAFKPEGKREAWLELWRQA :Sequence :cccTTTTTcTTccccccTTccHHHHHHHHH :Sec Str :########## :PROS|359->370|PS00198|4FE4S_FER_1|PDOC00176| :================= :RP:SCP|324->377|1durA|1e-11|34.6|52/55|d.58.1.1 :=============== :BL:SWS|1->58,147->375|IORA_PYRAB|1e-47|48.0|282/648 :========================== :BL:SWS|354->386|FER1_CAUCR|3e-04|42.4|33/113