[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL64946.1 paer1 AAL64946.1 "indolepyruvate ferredoxin oxidoreductase alpha subunit part 2, authentic frameshift"
MDKWRELEKLSSDFLQIEGSGDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGISVPVPPK
VREIARGGEVVVVEEGDPVVEIQLRALGINTRGKIDGYFPKHGELDINKTALGLAKALGL
SYAPPTPLKPPLEPPPRPPVLCPGCPHMATFYILRLATAGLNPVWSGDIGCYSLGINTGQ
QDLITHMGSSVGLGAGIALATGQFVVATVGDSTFYHAVLPQLVDIATRSVPILIVVMDNA
YTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSVEIIKKAVEIVKSGRPAVVVS
RRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCV
GCGICAEVCPFNAFKPEGKREAWLELWRQA
//