[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64972.1"

            "resolvase, conjectural"
            ""

OrgPattern -------1---------111111--------------------11-----------11---------- -2--------------------------------1-----------------------------------------------------11---1-----------------------------------------------------------------------------------------------------------1-------1-11------------------2-----------------------------------------------------------------------------------------------------------------1-----1-----------------------------------------------------------------------------------1----1--------11111111---1----------------------------------------------------------------1-------------------------------1-----------11------------------1-----------------------1-------------------------------1----1---1------------------------1-11--1-----1----1----1-------------------------------------------111-1111--------------------------------------------------------------1--------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MITAVTYIRVSTEEQDPENQRVFLERWAGERGIYIVKHYVDVGVSGATEPWERPAFRQMA:Sequence : cEEEEEEEEccccGGGHHHHHHHHHHHHHTTcEEEEEEEEETccccccHHccHHHHHHH:Sec Str : ######### :PROS|7->15|PS00397|RECOMBINASES_1|PDOC00334| : ======================================================:RP:SCP|7->156|1gdtA2|3e-18|26.1|134/140|c.53.1.1 : ========================================================:BL:SWS|5->200|RES2_CLOPE|1e-12|29.8|181/189 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->156|PF00239|3e-13|37.0|138/141|Resolvase 61: . . . * . .: 120 :SEVDKLEPRPRVLLVYEISRLVRSFQELFTLLDVVENRLGLVVVSASEREQALQNLDGVY:Sequence :HGGcTGGTcccEEEEccHHHHcccHHHHHHHHHHTTGGGTcEEEETTTTEEEEEETTcHH:Sec Str :============================================================:RP:SCP|7->156|1gdtA2|3e-18|26.1|134/140|c.53.1.1 :============================================================:BL:SWS|5->200|RES2_CLOPE|1e-12|29.8|181/189 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->156|PF00239|3e-13|37.0|138/141|Resolvase 121: . . + . . .: 180 :RQFLRAVLAFVATMEREFIRQRTKTALERARLQGKVWNVAEKRRDLTQAVVEMYLSGASL:Sequence :HHHHHHHHHHHHHHHHHHHcEEEEEEEEEEEEEEEcc cccccccHHHHHHHHHTTccH:Sec Str :==================================== :RP:SCP|7->156|1gdtA2|3e-18|26.1|134/140|c.53.1.1 : ======================================================:RP:SCP|127->198|2oa4A1|1e-06|12.9|70/93|a.4.12.3 :============================================================:BL:SWS|5->200|RES2_CLOPE|1e-12|29.8|181/189 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->156|PF00239|3e-13|37.0|138/141|Resolvase 181: . * . . . .: 240 :RETARAFGLSLYEVRRILSNAGVYRPSPYTCPRCFSKMKVAERTAKISNGKYTVVERLYC:Sequence :HHHHHHHTccHHHHHHHHHcc :Sec Str :================== :RP:SCP|127->198|2oa4A1|1e-06|12.9|70/93|a.4.12.3 :==================== :BL:SWS|5->200|RES2_CLOPE|1e-12|29.8|181/189 241: + . . . . *: 300 :YNCGYEEIREG :Sequence : :Sec Str