[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL65054.1"

            "conserved hypothetical protein"
            ""

OrgPattern 111111111111111111121112111222221111111111111111112111111111111111-- --1--1-----1---------1--11------1111-----------1-11-------------111-1---111111---1------------------------------------------1---1------------------1-----11--------1------------------------11-------------------------------------------------------------------------------------------------------------------------------------111----------------------1---1--------1-------11----1----------1---111-1--1------------------------------------------1-------111111111------1-22-11-------111111111-11------------111111111111111111111111-111-----1--------------11-1-1-1-------1---1-1------111--11-----1---1---1---1----------------------------11-1-11-1-1111111-1------11-11---1-----------1-1-1-----------------------------------111------------------------1-11111111111111-1-------------1---1-1------11-1111111111-1----1-1-1111--1111111111111-111-----11111---------------1------------------------------------------------11-111--1 22-1211-411111111111111111111-1111111111111111111111111111111111111111111111111111111112-12111111111111112112133512121222122312323F2-33611221-22--212132241322213412221222113211122E2212232331332112221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEVVDKSKLPYVYAADELISLFLTTYSREEARGSTAEPAFVKQKRLEIKRIVSSGKAIAS:Sequence : TTcccccHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHTTTccHHHHHH:Sec Str : ======:RP:SCP|55->176|1dioA|3e-04|10.9|119/551|c.1.19.3 : ====================================================:BL:SWS|9->324|NOG1_YEAST|9e-45|31.2|314/647 61: . . . * . .: 120 :ILREMALRMPFLDRLHPFYRELIDAVIGARAYKHVVAKVGNANLAVKAIAKEAITAVRTA:Sequence :HHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHTcccHHHHHHHHHHHHHHTc:Sec Str :============================================================:RP:SCP|55->176|1dioA|3e-04|10.9|119/551|c.1.19.3 :============================================================:BL:SWS|9->324|NOG1_YEAST|9e-45|31.2|314/647 121: . . + . . .: 180 :PDKKALLDARRMYKARIIDLLNDLRPELEKMREIVVFLRKLPSIDPELFTIVVAGAPNVG:Sequence :cHHHHHHHHTcccHHHHHTccHHHHHHHHHHHHHHHHGHHHHHTTccEEEEEEEccTTcc:Sec Str :======================================================== :RP:SCP|55->176|1dioA|3e-04|10.9|119/551|c.1.19.3 : ===========================:RP:SCP|154->346|1h65A|2e-15|14.5|193/257|c.37.1.8 :============================================================:BL:SWS|9->324|NOG1_YEAST|9e-45|31.2|314/647 181: . * . . . .: 240 :KSSFVRCVSTAKPEVAEYPFTTKQIHLGHIFLRGDRVQVIDTPGLLDRPLSERNQIEKQA:Sequence :HHHHHHHHHTTcEEEEEcTTcccEEEEEEEEETTEEEEEEEcccccccccccHHHHHHHH:Sec Str : ############ :PROS|199->210|PS00178|AA_TRNA_LIGASE_I|PDOC00161| :============================================================:RP:SCP|154->346|1h65A|2e-15|14.5|193/257|c.37.1.8 :============================================================:BL:SWS|9->324|NOG1_YEAST|9e-45|31.2|314/647 : $$$$$:RP:PFM|236->291|PF06858|1e-08|46.4|56/58|NOG1 241: + . . . . *: 300 :ILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFSAPAVAVLNKIDIATEEELEK:Sequence :HHHHHccccEEEEEEEcccccTTccHHHHHHHHHHHHTTTccEEEEEEcHHHHHHTTccc:Sec Str :============================================================:RP:SCP|154->346|1h65A|2e-15|14.5|193/257|c.37.1.8 :============================================================:BL:SWS|9->324|NOG1_YEAST|9e-45|31.2|314/647 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|236->291|PF06858|1e-08|46.4|56/58|NOG1 301: . . . . + .: 360 :ARAIFAPIGEISTLNCRGTKEVMDYVLQKYYVPAALEKLRAAARGR :Sequence :cHHHHccEEEccTTTcTTHHHHHHHHHHHHHccccccccccccccc :Sec Str :============================================== :RP:SCP|154->346|1h65A|2e-15|14.5|193/257|c.37.1.8 :======================== :BL:SWS|9->324|NOG1_YEAST|9e-45|31.2|314/647