[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL65054.1 paer1 AAL65054.1 "conserved hypothetical protein"
MEVVDKSKLPYVYAADELISLFLTTYSREEARGSTAEPAFVKQKRLEIKRIVSSGKAIAS
ILREMALRMPFLDRLHPFYRELIDAVIGARAYKHVVAKVGNANLAVKAIAKEAITAVRTA
PDKKALLDARRMYKARIIDLLNDLRPELEKMREIVVFLRKLPSIDPELFTIVVAGAPNVG
KSSFVRCVSTAKPEVAEYPFTTKQIHLGHIFLRGDRVQVIDTPGLLDRPLSERNQIEKQA
ILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFSAPAVAVLNKIDIATEEELEK
ARAIFAPIGEISTLNCRGTKEVMDYVLQKYYVPAALEKLRAAARGR
//