[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL65065.1"

            "conserved hypothetical protein"
            ""

OrgPattern 11-1111111111111--111111-----------------------------1-------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPLYLAVGGGGDVVMAAALAGEEAVGQIPWERYVVDPEPGPVPPPSLREVLDLGNGLYLA:Sequence : XXXXXXXXXXXXXXXX :SEG|6->21|avggggdvvmaaalag : XXXXXXXXXXXX :SEG|34->45|vvdpepgpvppp : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->289|PF06626|7e-41|43.5|262/297|DUF1152 61: . . . * . .: 120 :TPRSFAERGGRLFKTQGMCVAEALQKSVYLVDPYRRPSELAKALVRFDKIIGVDVGGDVL:Sequence : XXXXXXXXX:SEG|112->123|gvdvggdvlgvg :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->289|PF06626|7e-41|43.5|262/297|DUF1152 121: . . + . . .: 180 :GVGCEESLRSPLADAYGLAVLAKASELGVEAELWVMSPGADGELSLEYLIRRVAEAAREG:Sequence :XXX :SEG|112->123|gvdvggdvlgvg : ======================================================:BL:SWS|127->208|DAPB_RHOP2|4e-04|36.6|82/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->289|PF06626|7e-41|43.5|262/297|DUF1152 181: . * . . . .: 240 :GLLGTVGLDSKQVEVLEKLVKRCVTEASAVAVRAFKGEYGPAHIRGGARLVEIGACALIG:Sequence :============================ :BL:SWS|127->208|DAPB_RHOP2|4e-04|36.6|82/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->289|PF06626|7e-41|43.5|262/297|DUF1152 241: + . . . . *: 300 :FKFSPKALLKLNKAARLIYESDAPIDKAADLLIENGIPTELHLEQLLAKGLDIYAALEEL:Sequence : XXXXXXXXXX :SEG|246->255|kallklnkaa :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|25->289|PF06626|7e-41|43.5|262/297|DUF1152 301: . . . . + .: 360 :KKKKSC :Sequence