[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL65065.1 paer1 AAL65065.1 "conserved hypothetical protein"
MPLYLAVGGGGDVVMAAALAGEEAVGQIPWERYVVDPEPGPVPPPSLREVLDLGNGLYLA
TPRSFAERGGRLFKTQGMCVAEALQKSVYLVDPYRRPSELAKALVRFDKIIGVDVGGDVL
GVGCEESLRSPLADAYGLAVLAKASELGVEAELWVMSPGADGELSLEYLIRRVAEAAREG
GLLGTVGLDSKQVEVLEKLVKRCVTEASAVAVRAFKGEYGPAHIRGGARLVEIGACALIG
FKFSPKALLKLNKAARLIYESDAPIDKAADLLIENGIPTELHLEQLLAKGLDIYAALEEL
KKKKSC
//