[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL65069.1"

            "aminotransferase, putative"
            ""

OrgPattern -------1---------122-11-------------------------------2--1----11---- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------1111-11----------------------------------------------------------------------------1--------1-------------------------------------------------------------1---------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------------------1-------1-------------1------------------------------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYEIEMFKWIREKNGVYDLASSGVLKLEAPQAEAPPLEEVLIELYDIPRQNLAIVSGAQE:Sequence : HHHHHHTccGGGEEEEccHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|25->39|lkleapqaeapplee : ==================:RP:SCP|43->195|1fg3A|1e-15|21.1|152/355|c.67.1.1 : ===============:BL:SWS|46->198|AAT_PYRHO|2e-09|28.1|153/391 61: . . . * . .: 120 :GNFLAFLAVKPEYAVITVPEYEPIIKLPSSLGVRHVKVWDVWEAPIKPGGVLIFSNPNNP:Sequence :HHHHHHHHHccTTcEEEEcccHHHHHHHHTTccEEEEEHHHHHHHcccccEEEcccccTT:Sec Str :============================================================:RP:SCP|43->195|1fg3A|1e-15|21.1|152/355|c.67.1.1 :============================================================:BL:SWS|46->198|AAT_PYRHO|2e-09|28.1|153/391 : $$$$$$$$$$:RP:PFM|111->308|PF00155|8e-06|30.9|191/341|Aminotran_1_2 121: . . + . . .: 180 :TGRYLEKRELAELADEARRKGAYLIIDIIFSDFVTDDLRGFPLENVAYSHSTDKFYTHDL:Sequence :TcccccHHHHHHHHHHHHHTTccEEEEcTTTTcccccHHHHTcccEEEEEEcTTTTccTT:Sec Str :============================================================:RP:SCP|43->195|1fg3A|1e-15|21.1|152/355|c.67.1.1 :============================================================:BL:SWS|46->198|AAT_PYRHO|2e-09|28.1|153/391 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|111->308|PF00155|8e-06|30.9|191/341|Aminotran_1_2 181: . * . . . .: 240 :RAGWVFGDEEIVRRVKYLKDLANPGPREAERKAAAALLSRRAEVKRRNLSIIKPNATALL:Sequence :ccEEEEccHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXX :SEG|207->223|reaerkaaaallsrrae :=============== :RP:SCP|43->195|1fg3A|1e-15|21.1|152/355|c.67.1.1 :================== :BL:SWS|46->198|AAT_PYRHO|2e-09|28.1|153/391 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|111->308|PF00155|8e-06|30.9|191/341|Aminotran_1_2 241: + . . . . *: 300 :TRFPNALYKPHMPIALIPTGCNDAKLAERLLAMGVKTVPGRLFQAPYSIRVGLGVEEPPR:Sequence :HHccTTcEEccEEEEEccTTccHHHHHHHHHHTTEEcEEcGGGcTTTEEEEEcccccHHH:Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|111->308|PF00155|8e-06|30.9|191/341|Aminotran_1_2 301: . . . . + .: 360 :FREALEILAQGWCRA :Sequence :HHHHHHHHHHHHHTT :Sec Str :$$$$$$$$ :RP:PFM|111->308|PF00155|8e-06|30.9|191/341|Aminotran_1_2