[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL65085.1"

            "pyruvate formate-lyase activating enzyme homolog"
            ""

OrgPattern 111222111111111121222214-----1--111111212112212312432311111121112111 -1---------------11-1-----11111---------------------------------1------------1--11-11111--1----------------------------------11-------1-111221111-----------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------11-1-------------11------2-----1111111223121-1111--1----------------------------------------1----------------------------------------------1-1-----------------------------------------------------------------11--------------1----11---------------111-212-121121111-1111111341121-112--------------------1-12211--1-------1-------1----1-1--11-----11--------------------------------------------------------------------------------------------------11111-1-----------------------------------------------------------1--------------------------1---------------1---------------------------1111111111-1- -----------1-------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSRAVYSWPAPVYKPGEYLLKLPNVRESPYQTREEGGSVVCTLCHRRCRLPPGKIGACGM:Sequence : :Sec Str : ====================================:BL:SWS|25->349|Y808_METJA|2e-52|34.8|322/333 61: . . . * . .: 120 :RFNLGGRLYTAAYGLLTAAESRPMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSK:Sequence : HHHHHHHHHHccEEEEEEEEEEEEcccccccTTcTTcTTcc:Sec Str : XXXXXXXXXXXX :SEG|68->79|lytaayglltaa : ==============================:RP:SCP|91->262|1r30A|8e-25|25.1|171/314|c.1.28.1 :============================================================:BL:SWS|25->349|Y808_METJA|2e-52|34.8|322/333 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|101->255|PF04055|1e-05|26.6|154/164|Radical_SAM 121: . . + . . .: 180 :TASPAGAYVPPERVVEWALENGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNG:Sequence :ccccccccHHHHHHHHHHHHTccccEEEcccTGGGcHHHHHHHHHHHHHTTccEEEEcTT:Sec Str :============================================================:RP:SCP|91->262|1r30A|8e-25|25.1|171/314|c.1.28.1 :============================================================:BL:SWS|25->349|Y808_METJA|2e-52|34.8|322/333 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|101->255|PF04055|1e-05|26.6|154/164|Radical_SAM 181: . * . . . .: 240 :YLTEEAVRRLAEAGMEGMNIDIKGGRETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLV:Sequence :cccHHHHHHHHTccEcEEEEEccccHHHHHHHHccccHHHHHHHHHHHHTTccEEEEEEE:Sec Str :============================================================:RP:SCP|91->262|1r30A|8e-25|25.1|171/314|c.1.28.1 :============================================================:BL:SWS|25->349|Y808_METJA|2e-52|34.8|322/333 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|101->255|PF04055|1e-05|26.6|154/164|Radical_SAM 241: + . . . . *: 300 :IPGVNDHEAEEVIEAVASFGRETPLHITAYYPAHKLFNPPTPPELLEELWRRARRELDYV:Sequence :ccTTTccHHHHHHHHHHHHHHHcccccccccTTcTTTT HHcTTcEEE:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|279->297|pptppelleelwrrarrel :====================== :RP:SCP|91->262|1r30A|8e-25|25.1|171/314|c.1.28.1 :============================================================:BL:SWS|25->349|Y808_METJA|2e-52|34.8|322/333 :$$$$$$$$$$$$$$$ :RP:PFM|101->255|PF04055|1e-05|26.6|154/164|Radical_SAM 301: . . . . + .: 360 :YVGNVPGHPGQHTYCPRCGYAVIKRAGDRAVKIELAQGRCPKCGWEIPIRGKPGKYGRLY:Sequence :EEEcTTHHHHHHHHHHHTTcEEEEcTTT ccccccccccccHHH :Sec Str :================================================= :BL:SWS|25->349|Y808_METJA|2e-52|34.8|322/333 361: . . . * . .: 420 :RSFI :Sequence : :Sec Str