[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL65085.1 paer1 AAL65085.1 "pyruvate formate-lyase activating enzyme homolog"
MSRAVYSWPAPVYKPGEYLLKLPNVRESPYQTREEGGSVVCTLCHRRCRLPPGKIGACGM
RFNLGGRLYTAAYGLLTAAESRPMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSK
TASPAGAYVPPERVVEWALENGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNG
YLTEEAVRRLAEAGMEGMNIDIKGGRETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLV
IPGVNDHEAEEVIEAVASFGRETPLHITAYYPAHKLFNPPTPPELLEELWRRARRELDYV
YVGNVPGHPGQHTYCPRCGYAVIKRAGDRAVKIELAQGRCPKCGWEIPIRGKPGKYGRLY
RSFI
//