[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ20838.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKQIVKNFNNLINKTIFKLKNKTNNKFHVSTFNKYIITTIIILFTYIFYLLIPLLYDKNW:Sequence : XXXXXXXXXXXXXXXXXX :SEG|35->52|yiittiiilftyifylli 61: . . . * . .: 120 :IQNKVVTKLGNEFNINLSNSFDISYRILPKPHYLIRDSKISLAEIKTLNVFISQNNFFNK:Sequence 121: . . + . . .: 180 :DSIRINEVVIEEANFSLLSNNLKPLYKDSENKFSKKKIKINNSNIFLKDNLNEVISIIKI:Sequence : XXXXXXXXXXXXXXXX :SEG|151->166|nkfskkkikinnsnif 181: . * . . . .: 240 :SNAFLFFDEKNLFNLFDLNGEIFNIPFTLNYQNTINSQKNINIKAPDLKLKIIDKFFKKD:Sequence : XXXXXXXXXXXXXX:SEG|227->244|dlklkiidkffkkdedlk 241: + . . . . *: 300 :EDLKSGMNNISILNSSINTKYSIKDQIVIFQSDGSRIYNSKIDYNGQLAINPFDLNLKIN:Sequence :XXXX :SEG|227->244|dlklkiidkffkkdedlk : XXXXXXXXXXX :SEG|248->258|nnisilnssin : ======================:BL:SWS|279->348|RPOC2_CHLRE|2e-04|34.3|67/3120 301: . . . . + .: 360 :LYDYKISNLFTPNSIIYEFIKSGLLFNENISVQTLVNIKSTKKDKIFNEAKLELKVLNGK:Sequence :================================================ :BL:SWS|279->348|RPOC2_CHLRE|2e-04|34.3|67/3120 361: . . . * . .: 420 :INFDKSMFINNNIGLLEVSNSDLFLENDRLILTANLSIDIKDIDKLYSFLNTSKNSRKNI:Sequence : XXXXXXXX:SEG|413->428|sknsrknirniklnii 421: . . + . . .: 480 :RNIKLNIIYDLLGDEIAFKNIKIDENKVSDQFYNITEGFNDTNFNNLTKSRRLLNELIGL:Sequence :XXXXXXXX :SEG|413->428|sknsrknirniklnii 481: . * . . . .: 540 :YEG :Sequence