[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ20838.1 pubi0 AAZ20838.1 "hypothetical protein"
MKQIVKNFNNLINKTIFKLKNKTNNKFHVSTFNKYIITTIIILFTYIFYLLIPLLYDKNW
IQNKVVTKLGNEFNINLSNSFDISYRILPKPHYLIRDSKISLAEIKTLNVFISQNNFFNK
DSIRINEVVIEEANFSLLSNNLKPLYKDSENKFSKKKIKINNSNIFLKDNLNEVISIIKI
SNAFLFFDEKNLFNLFDLNGEIFNIPFTLNYQNTINSQKNINIKAPDLKLKIIDKFFKKD
EDLKSGMNNISILNSSINTKYSIKDQIVIFQSDGSRIYNSKIDYNGQLAINPFDLNLKIN
LYDYKISNLFTPNSIIYEFIKSGLLFNENISVQTLVNIKSTKKDKIFNEAKLELKVLNGK
INFDKSMFINNNIGLLEVSNSDLFLENDRLILTANLSIDIKDIDKLYSFLNTSKNSRKNI
RNIKLNIIYDLLGDEIAFKNIKIDENKVSDQFYNITEGFNDTNFNNLTKSRRLLNELIGL
YEG
//