[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ20988.1"

            "membrane protein"
            ""

OrgPattern -------------------------------------------------------------------- ----1---------1------1---2------1111-11-----1211111-111-----111-1112121---------1---------------------------------------------------------------11---------------------------------------1-------222222-22-221122-122111211-121-1-----12---------------------11-------------------------------------------------------------------1-11-1-------1-1-211---------1----11-----1---------------1--------------1---------------------------------------------------------------------1-----------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-------------------------------111-------------------------------------------------------------1111-1-11-11111-----------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFLKIKDIPKVYWSSEKPLNLKPKISTFFFLCLGLVLFGLGEGLLIVSFAGASPWSILAQ:Sequence : XXXXXXXXXXXXXXXXXX :SEG|28->45|ffflclglvlfglgegll : =========================================================:BL:SWS|4->177|Y522_HAEIN|2e-24|32.6|172/218 61: . . . * . .: 120 :GIALNVDLSIGIITVLISIGVLFLWLPLKQKPGIGTILNAIIIGLMIDVCIKFIPTPENY:Sequence :============================================================:BL:SWS|4->177|Y522_HAEIN|2e-24|32.6|172/218 121: . . + . . .: 180 :LNQLILATIAVLTVGLGGGIYLVANLGAGPRDGLMVGLQKKTNLPIATVRAFLEITVMSI:Sequence :========================================================= :BL:SWS|4->177|Y522_HAEIN|2e-24|32.6|172/218 181: . * . . . .: 240 :GWYLGGTVGIGTLLFAFGIGPSVALGLYLVGKTFN :Sequence