[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ20988.1 pubi0 AAZ20988.1 "membrane protein"
MFLKIKDIPKVYWSSEKPLNLKPKISTFFFLCLGLVLFGLGEGLLIVSFAGASPWSILAQ
GIALNVDLSIGIITVLISIGVLFLWLPLKQKPGIGTILNAIIIGLMIDVCIKFIPTPENY
LNQLILATIAVLTVGLGGGIYLVANLGAGPRDGLMVGLQKKTNLPIATVRAFLEITVMSI
GWYLGGTVGIGTLLFAFGIGPSVALGLYLVGKTFN
//