[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21102.1 pubi0 AAZ21102.1 "Unknown protein"
MKHYKLISRFIFIIFFSLLSSVVYAEENSSKFNVYSGMFDFSDTGKKSTLIGFQHQNEDL
NRDTFLGNISPITGALVTADSAAYIYTGVQAQYKLGKINFTPSFAPGLYSKGDGKDLGHI
LEFKSELQISVDFVSNSQLGFSYNHLSNASLGTKNPGANSYMFNFFKTF
//