[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21120.1 pubi0 AAZ21120.1 "possible transmembrane protein"
MNNKFFEWAGVITAILYSMFVALNIGIEFLGFCLLLLSAILIGIWAYRGGHKGILVLQFF
YATAGIIGMIRWF
//