[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21175.1"

            "ParA family ATPase for plasmid partitioning and other plasmid related functions"
            ""

OrgPattern -------1111111111-------78612151112-1------11-11---1--12222241-1---1 2111222222222243335-3422433333333333255623344232333233422233223234324222222222113111-1--222412111--111111212312122111112111122222222232432233---225352443-211------421-5753------------4242211121112122112111111111111122312211--211111143------------------15121321-11112111114-331-1------1------------------------1---1-----1---132221112111223221112111221212212111214121111111--222411211111111134121212122222222226-234127125311444895496754124213133112111222222222112132211-11111--1111111131111111-111132111111233322221111224411111122313331111132121121331223121322121111123142134551322372332511111123334334411211111111111122122111121113242363222412242222232222322222---2443-------1-2-11-11----11--1---1-----11-------21211--1-----1-1---------------------------1-----122212221124422------------2--22333221112423322334333553335---------14345333334333322233332222112--225544449G98327111----------1-11-----11---------1-----131 -----------------------------------------------------------------------------------------------------------------------------------------------1--------------1-----------1---1-------------4--------1- ----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTI:Sequence :ccEEEEEEEcTTccHHHHHHHHHHHHHHHTccEEEEEccTTccTTHHHTccccccHHHHH:Sec Str :============================================================:RP:SCP|1->257|1cp2A|3e-44|20.4|245/269|c.37.1.10 :============================================================:BL:SWS|1->258|PARA_CAUCR|2e-73|52.9|255/267 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->191|PF01656|5e-22|42.0|157/178|CbiA 61: . . . * . .: 120 :YGVLNGTRVISDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSR:Sequence :HHHccTTcccHHHHcEEcGGGcEEEEcccccTTccccTHHHHHHHHHHHHHHHHHTTccc:Sec Str :============================================================:RP:SCP|1->257|1cp2A|3e-44|20.4|245/269|c.37.1.10 :============================================================:BL:SWS|1->258|PARA_CAUCR|2e-73|52.9|255/267 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->191|PF01656|5e-22|42.0|157/178|CbiA 121: . . + . . .: 180 :ATYDYVLIDCPPSLSLLTVMALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPEL:Sequence :ccccEEEEEEEcccccTTTTHHHHTTcccEEEEEEcccHHHHHHHHHHHHHHHHTTTccc:Sec Str : ########### :PROS|138->148|PS00435|PEROXIDASE_1|PDOC00394| :============================================================:RP:SCP|1->257|1cp2A|3e-44|20.4|245/269|c.37.1.10 :============================================================:BL:SWS|1->258|PARA_CAUCR|2e-73|52.9|255/267 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->191|PF01656|5e-22|42.0|157/178|CbiA 181: . * . . . .: 240 :KIRGILLTMFDKRNKLSTQVEKEARDYFNEKVYLTVIPRNVRLSEAPSHGMPVLMYDKSC:Sequence :EEEEEEEEccccTTcHHHHHHHHHHHHHTccEcEEEEcccHHHHHHHHTTccHHHHcccc:Sec Str :============================================================:RP:SCP|1->257|1cp2A|3e-44|20.4|245/269|c.37.1.10 :============================================================:BL:SWS|1->258|PARA_CAUCR|2e-73|52.9|255/267 :$$$$$$$$$$$ :RP:PFM|5->191|PF01656|5e-22|42.0|157/178|CbiA 241: + . . . . *: 300 :PGSKSYFNFTDEFINQEQTIGSAA :Sequence :HHHHHHHHHHHHHHHcHH :Sec Str :================= :RP:SCP|1->257|1cp2A|3e-44|20.4|245/269|c.37.1.10 :================== :BL:SWS|1->258|PARA_CAUCR|2e-73|52.9|255/267