[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21181.1"

            "putative porin"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNNLKKIGLTALAGCLAVTSVHASELTASGSASIGFGGADKGTSANGFYMNDEVTFSGSG:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|28->39|asgsasigfgga 61: . . . * . .: 120 :ELDNGWNVTLSMQVDNNENVGTSTFDNRSVTINMGDAGTFAFGGHGLDSVVGGVDDVMPT:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|103->117|gghgldsvvggvddv 121: . . + . . .: 180 :AYGETWDIISNTVDNGGVTSTASTLFGAIGSAGSNNMMRYDNTTAVEGLKISASYVPSGT:Sequence : :Sec Str : ===================================:BL:SWS|146->309|ICEK_PSESX|4e-05|31.4|140/1148 181: . * . . . .: 240 :GEVESSVDYGLEYTGYEGLTLGYAMGENNAAGGTSNTDNDTMYVKYAYGPVTVGYQKSEI:Sequence : cEEEEEETTEEEEEEEcccccccccc ccccTTTTcccE:Sec Str :============================================================:BL:SWS|146->309|ICEK_PSESX|4e-05|31.4|140/1148 241: + . . . . *: 300 :DATTATDTDEWTAYGVTYAVSDSLSVGYAESTYDAGSSTTDQENSNLSVSYTQGGMTLAA:Sequence : EEEEEEETTEEEEEEEEccEEccEEEEcTTccEEEEccc cccEEEE:Sec Str :XXXXXXXXXXXXX :SEG|241->253|dattatdtdewta :============================================================:BL:SWS|146->309|ICEK_PSESX|4e-05|31.4|140/1148 301: . . . . + .: 360 :GFAEEKNRGGLTTAVNDVKGYDISLAFAF :Sequence :EEEccTTccc :Sec Str :========= :BL:SWS|146->309|ICEK_PSESX|4e-05|31.4|140/1148