[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21387.1"

            "O-Antigen Polymerase"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHLYQNKKDTLLYLLYVFPIILVFSKFLAEILILVTLCYLILFNKKVTFQIIKKDFFFKS:Sequence 61: . . . * . .: 120 :FLVYICILIILSFFSADILPSLKRSVSYFRFIFFIIFIKYFFLTNEKRFINFLLITSLFL:Sequence : XXXXXXXXXXXXXX :SEG|89->102|frfiffiifikyff : XXXXXXXXXXXX:SEG|109->132|finfllitslfliilsldiffqff 121: . . + . . .: 180 :IILSLDIFFQFFNGKDILGHPSVSEGKRNSGFFGDEFIAGGYIVLFFFPCLLLSNINKYK:Sequence :XXXXXXXXXXXX :SEG|109->132|finfllitslfliilsldiffqff : XXXXX:SEG|176->196|inkykniilfliiifpttivi 181: . * . . . .: 240 :NIILFLIIIFPTTIVITGERSSLFLMFLGLILSLPLLIRDKRLSIALISSLILMTLTINF:Sequence :XXXXXXXXXXXXXXXX :SEG|176->196|inkykniilfliiifpttivi : XXXXXXXXXXXXXXXXXX :SEG|201->218|sslflmflglilslplli : XXXXXXXXXXXXXXXX :SEG|223->238|lsialisslilmtlti 241: + . . . . *: 300 :SSNVNNRIIQTTISQVTKGFDNKYFQNKEFVKEYDENSINNKKNRIGFLNSGWGAHILTA:Sequence 301: . . . . + .: 360 :VEIWRDYPIYGSGLKTFRKLCSNEKYEKIKSLNFKNRCATHPHQIYFEILSETGVIGFFS:Sequence : XXXXX:SEG|356->368|igffsiiiifiii 361: . . . * . .: 420 :IIIIFIIILNRMFKILIVNKKEYSSILVLFTPIIIKLWPLTTTGSFFSNYNLILLSFFIG:Sequence :XXXXXXXX :SEG|356->368|igffsiiiifiii 421: . . + . . .: 480 :FVLSLENLDINKLTKFS :Sequence