[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21387.1 pubi0 AAZ21387.1 "O-Antigen Polymerase"
MHLYQNKKDTLLYLLYVFPIILVFSKFLAEILILVTLCYLILFNKKVTFQIIKKDFFFKS
FLVYICILIILSFFSADILPSLKRSVSYFRFIFFIIFIKYFFLTNEKRFINFLLITSLFL
IILSLDIFFQFFNGKDILGHPSVSEGKRNSGFFGDEFIAGGYIVLFFFPCLLLSNINKYK
NIILFLIIIFPTTIVITGERSSLFLMFLGLILSLPLLIRDKRLSIALISSLILMTLTINF
SSNVNNRIIQTTISQVTKGFDNKYFQNKEFVKEYDENSINNKKNRIGFLNSGWGAHILTA
VEIWRDYPIYGSGLKTFRKLCSNEKYEKIKSLNFKNRCATHPHQIYFEILSETGVIGFFS
IIIIFIIILNRMFKILIVNKKEYSSILVLFTPIIIKLWPLTTTGSFFSNYNLILLSFFIG
FVLSLENLDINKLTKFS
//