[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21400.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATAVWLVENTTLTFKQISKFCNLHEVEVQGIADGEVAKGIMAYNPIISGQLTREEIELA:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->156|PF06242|1e-38|52.3|130/141|DUF1013 61: . . . * . .: 120 :SKDENKELQIKNTDIEISTEDKKIKKYIPLSKRQDKPDSALWLIKHHSLLKDSQIAKLVG:Sequence : ===========================================================:BL:SWS|62->145|FLIF_TREPA|6e-05|39.1|69/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->156|PF06242|1e-38|52.3|130/141|DUF1013 121: . . + . . .: 180 :ITKASVTAIKNKSYWNYNNLNPKDPVALGLFSQKDLIEAIEKAERRIKREKKEKEKAKLT:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|157->178|ieaiekaerrikrekkekekak :========================= :BL:SWS|62->145|FLIF_TREPA|6e-05|39.1|69/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|27->156|PF06242|1e-38|52.3|130/141|DUF1013 181: . * . . . .: 240 :REVSNIE :Sequence