[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21400.1 pubi0 AAZ21400.1 "hypothetical protein"
MATAVWLVENTTLTFKQISKFCNLHEVEVQGIADGEVAKGIMAYNPIISGQLTREEIELA
SKDENKELQIKNTDIEISTEDKKIKKYIPLSKRQDKPDSALWLIKHHSLLKDSQIAKLVG
ITKASVTAIKNKSYWNYNNLNPKDPVALGLFSQKDLIEAIEKAERRIKREKKEKEKAKLT
REVSNIE
//