[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21413.1"

            "protein with conserved domain of unknown function DUF28"
Y592_PELUB  "RecName: Full=UPF0082 protein SAR11_0592;"

OrgPattern -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111-1111--111121111111111111111111111111111111111111111111111111111111111111111111-1-----1----111111111111111111111111111122121111111111222222111--111111111-111-111211111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111121112222121111111111111111111111111111111111111111111111111212111111111111111111111111111111111111121212222222222222222222--11111------11111112222222222-2222222222222222222111111112122222222222222122112221-111111111111--12111111111121211111111111111111111111111221111222222222222211111111111112111111111111111111111111111111111111111111111----1-11111111111-11111111111111111121 ------1-------1111111111111111111111-1111111111-111-1111--11-1111111111-11111-1111111111--2111-11111---111-111112111--1111111211-111-11111-111111----11--11--12---1-11-111-11222111111111-1111141221112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSAN:Sequence : ccccccccccccccTTTcHHHHHHHHHHHHHHHHHHHcccGGGcHHHHHHHHHHHHTT:Sec Str : ==========================================================:RP:SCP|3->238|1konA|2e-65|36.2|224/233|e.39.1.1 :============================================================:BL:SWS|1->241|Y592_PELUB|e-116|100.0|241/241 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->235|PF01709|7e-46|45.5|231/234|DUF28 61: . . . * . .: 120 :MPKDNIERAIAKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSG:Sequence :ccHHHHHHHHHHHHcccccccEEEEEEEEETTTEEEEEEEEEccHHHHHHHHHHHHHHTT:Sec Str :============================================================:RP:SCP|3->238|1konA|2e-65|36.2|224/233|e.39.1.1 :============================================================:BL:SWS|1->241|Y592_PELUB|e-116|100.0|241/241 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->235|PF01709|7e-46|45.5|231/234|DUF28 121: . . + . . .: 180 :GNLGTQGSASHNFNQLGIIKIDKKEISDEQIFELAIESGADECISNDEFHEIQCPMSEIY:Sequence :cEEccTTccGGGEEEEEEEEEEGGGccHHHHHHHHHHHTccEEEccccEEEEEEcGGGHH:Sec Str : XXXXXXXXXXXXXX :SEG|138->151|iikidkkeisdeqi :============================================================:RP:SCP|3->238|1konA|2e-65|36.2|224/233|e.39.1.1 :============================================================:BL:SWS|1->241|Y592_PELUB|e-116|100.0|241/241 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->235|PF01709|7e-46|45.5|231/234|DUF28 181: . * . . . .: 240 :NVKKNLEKTIANFISTEIEWVPLNSVDVEKDKVEAALEFLETLEDDDDVQSVYSNINFKN:Sequence :HHHHHHHTTTccccEEEEEEEEcccEEcccHHcHHHHHHHHHHHHcccEEEEEEc :Sec Str : XXXXXXXXXXXXXXX :SEG|214->228|eaalefletledddd :========================================================== :RP:SCP|3->238|1konA|2e-65|36.2|224/233|e.39.1.1 :============================================================:BL:SWS|1->241|Y592_PELUB|e-116|100.0|241/241 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->235|PF01709|7e-46|45.5|231/234|DUF28 241: + . . . . *: 300 :N :Sequence : :Sec Str := :BL:SWS|1->241|Y592_PELUB|e-116|100.0|241/241