[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21413.1 pubi0 AAZ21413.1 "protein with conserved domain of unknown function DUF28"
MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSAN
MPKDNIERAIAKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSG
GNLGTQGSASHNFNQLGIIKIDKKEISDEQIFELAIESGADECISNDEFHEIQCPMSEIY
NVKKNLEKTIANFISTEIEWVPLNSVDVEKDKVEAALEFLETLEDDDDVQSVYSNINFKN
N
//