[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21453.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------112--111112---------------------1------------------------------------------1-------------------------------1-----------------------------------1---------1-------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------111------------------------------------------11111-----------------------------------------------------1------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFYSFLIIHLILWTLIPTLTNNNLPLDTIEALAWGSNLDWGFNKHPPASAFFPEVIYQVF:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|6->29|liihlilwtliptltnnnlpldti 61: . . . * . .: 120 :GSQDWFYYLLSQLFVVTAFIIVFKFAEELFKNKTLSLISVLLLEGIYFYNFTTPEFNVNV:Sequence : :Sec Str : ==========================:BL:SWS|95->237|NU5M_TRYBB|1e-05|27.2|125/590 121: . . + . . .: 180 :CQLPFWSLCVYYSWKIFDKKVINFKHCFLLGVFAAVGFLSKYLFVYLLISIVLLFFYIIF:Sequence : cEEEEEEEEGGGcccccTTcccEEEEEEcccEEEEEEEccccccHHHHHcc:Sec Str :============================================================:BL:SWS|95->237|NU5M_TRYBB|1e-05|27.2|125/590 181: . * . . . .: 240 :VKKYQKFDFKYLISFEVFIVLLIPHLIWLTNNDYITITYGLARTGLETSSLLDHITYPLI:Sequence :cHHHHHHHHHHHHHTTcccccccGGGEEEcTTccEEEcccccGGGccccc :Sec Str :========================================================= :BL:SWS|95->237|NU5M_TRYBB|1e-05|27.2|125/590 241: + . . . . *: 300 :FLGKQIGILIPFFLMSFFLIKKIKLKVTLKDKKLLFLIFINLIPIGLMFLTSMLTGSKIR:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|252->287|fflmsfflikkiklkvtlkdkkllflifinlipigl 301: . . . . + .: 360 :TMWMTPFYLFFGVFIIYIFQAQINLKMLNGFISIFLILFIFSPFAYAYISITETDKRTDY:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|331->342|fisiflilfifs 361: . . . * . .: 420 :LGKEIAIKTEYLWKQNYTLPINVVLGDEWHAGNLSYHLNSRPVWEGVITKDKLNSLSKYI:Sequence : :Sec Str 421: . . + . . .: 480 :CIDNICVGNR :Sequence : :Sec Str