[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21453.1 pubi0 AAZ21453.1 "conserved hypothetical protein"
MFYSFLIIHLILWTLIPTLTNNNLPLDTIEALAWGSNLDWGFNKHPPASAFFPEVIYQVF
GSQDWFYYLLSQLFVVTAFIIVFKFAEELFKNKTLSLISVLLLEGIYFYNFTTPEFNVNV
CQLPFWSLCVYYSWKIFDKKVINFKHCFLLGVFAAVGFLSKYLFVYLLISIVLLFFYIIF
VKKYQKFDFKYLISFEVFIVLLIPHLIWLTNNDYITITYGLARTGLETSSLLDHITYPLI
FLGKQIGILIPFFLMSFFLIKKIKLKVTLKDKKLLFLIFINLIPIGLMFLTSMLTGSKIR
TMWMTPFYLFFGVFIIYIFQAQINLKMLNGFISIFLILFIFSPFAYAYISITETDKRTDY
LGKEIAIKTEYLWKQNYTLPINVVLGDEWHAGNLSYHLNSRPVWEGVITKDKLNSLSKYI
CIDNICVGNR
//