[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21647.1"

            "probable MFS transporter (Major Facilitator Superfamily)"
            ""

OrgPattern -----------------------1-------------------------------------------- -------------------------1----------1111--1---------111---------2-1111---------------------------------------------------------------------------1-----------------------1-------------11--------1---------------1-11-1----------------11--------------------------------------------------------------------------------------------------------------------------------------------------------1-4221-22122211111111111-1111111111--12211111111122---1111111112-------------411-----------------------------1--2--131352222222222222222222122224434-122112122222321112-----1-1-11-1---122------------------------11-1--1--------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------2---------------111111----1-11111111111111111-----------111-----111-----1-11------------------------------------------------------------------ -------------------------------------------------------1-----------------------------------------------213----1-----------------------------------------------------1---------------------------------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSEKFIQNKTALITLIAACIVVLISLGVRQTFGLFFMDFKNDLDISITQSGLAIGIQML:Sequence : =========================================================:RP:SCP|4->170|1pw4A|2e-07|10.8|166/434|f.38.1.1 : =================================================:BL:SWS|12->97,216->401|YBFB_BACSU|8e-18|26.5|271/416 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->275|PF07690|1e-06|25.2|230/347|MFS_1 61: . . . * . .: 120 :MWGLTGPIFGAIADKYGGHKAICLAFVFYILGIYFLYAGPNTGIFFQIDLGLLVGIGLGG:Sequence : XXXXXXXXXXX:SEG|110->120|lgllvgiglgg :============================================================:RP:SCP|4->170|1pw4A|2e-07|10.8|166/434|f.38.1.1 :===================================== :BL:SWS|12->97,216->401|YBFB_BACSU|8e-18|26.5|271/416 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->275|PF07690|1e-06|25.2|230/347|MFS_1 121: . . + . . .: 180 :TAISIPMSIVGKHFPLSNRTIAMSIVTAVGSLGYFISPLYTSYSLIKNGWVDTLFVFTIF:Sequence : XXXXXXX:SEG|174->190|lfvftiflfigliiaff :================================================== :RP:SCP|4->170|1pw4A|2e-07|10.8|166/434|f.38.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->275|PF07690|1e-06|25.2|230/347|MFS_1 181: . * . . . .: 240 :LFIGLIIAFFVRSPSAAQSIEKPNNQSAIEAFKEAFKNKSYILLVSGFFVCGFHITLVGT:Sequence :XXXXXXXXXX :SEG|174->190|lfvftiflfigliiaff : =========================:BL:SWS|12->97,216->401|YBFB_BACSU|8e-18|26.5|271/416 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->275|PF07690|1e-06|25.2|230/347|MFS_1 241: + . . . . *: 300 :HVPKYVIDRGLESWTAAAILSLIGLFNIFGSLLSGYLSTKISKKIILSSIYALRGISIIL:Sequence : XXXXXXXXXXXXXX :SEG|277->290|lstkiskkiilssi :============================================================:BL:SWS|12->97,216->401|YBFB_BACSU|8e-18|26.5|271/416 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->275|PF07690|1e-06|25.2|230/347|MFS_1 301: . . . . + .: 360 :FIFLPASNINAFIFGASFGFLWLSTVPATSGIVAHIFGTKYLGILYGIVFLSHQVGSFFG:Sequence : XXXXX:SEG|356->367|gsffgaflgglf :============================================================:BL:SWS|12->97,216->401|YBFB_BACSU|8e-18|26.5|271/416 361: . . . * . .: 420 :AFLGGLFHDLYGSYDYAWYLAIVLSIFAAIIHLPIKEEAVLRLKIE :Sequence :XXXXXXX :SEG|356->367|gsffgaflgglf :========================================= :BL:SWS|12->97,216->401|YBFB_BACSU|8e-18|26.5|271/416