[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21667.1"

            "arylesterase"
            ""

OrgPattern -------------------------------------------------------------------- 1-1----------------------------------------------------------------------------------------------------11--111------------------------1-------------------------------------------------------1------------------------------------------------------------------------1--------------------------------------------------------------------------------11-----1---------------------1--1111-----111111111111111111111111-11111111111-11111111111111---1111111111---------11--111-----------------------------11111-111111111111111111111111111111111-11111111111112111121211111111111111111-1-1-12-11111-1-11-1-1--------1---------------------------111111111111111111111111122111---1111------11111111111111111-11111111-11111111111111111111111111111111111111---1--111111111111---2---------11111---------------11111111111111111111111111111111-111111111111111111111111111111--------111111-----------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIKRFIIKIIAVCLVSINVNALENVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLG:Sequence : cEcEEEEEcHHHHHHHHTccccHHHHHHHcHHHHTGGGc:Sec Str : ########### :PROS|25->35|PS01098|LIPASE_GDSL_SER|PDOC00842| : ====================================:RP:SCP|25->198|1ivnA|9e-25|35.9|170/178|c.23.10.5 : =========================================================:BL:SWS|4->202|ESTE_VIBMI|5e-32|34.8|198/200 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->134|PF00657|4e-05|34.5|110/201|Lipase_GDSL 61: . . . * . .: 120 :IIDGSVSGSTSAGGLNRVEWSLSQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAK:Sequence :EEEEEcTTccHHHHHHHHHTTTTTTccccEEEEEEccTTcTTccHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|25->198|1ivnA|9e-25|35.9|170/178|c.23.10.5 :============================================================:BL:SWS|4->202|ESTE_VIBMI|5e-32|34.8|198/200 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->134|PF00657|4e-05|34.5|110/201|Lipase_GDSL 121: . . + . . .: 180 :LKNIEIILAGMIAPTTHGISYKKKFDNIYPSLAQKYELNLIPFLLEGVALKPELNQEDGM:Sequence :HHcTTcEEEEEccccccccccHHHHHHHHHHHHccTTEEEEcccccTTccccTTTcTTcc:Sec Str :============================================================:RP:SCP|25->198|1ivnA|9e-25|35.9|170/178|c.23.10.5 :============================================================:BL:SWS|4->202|ESTE_VIBMI|5e-32|34.8|198/200 :$$$$$$$$$$$$$$ :RP:PFM|25->134|PF00657|4e-05|34.5|110/201|Lipase_GDSL 181: . * . . . .: 240 :HPNEKGTIIISDTLTKSIINFIKK :Sequence :cccHHHHHHHHHHHHHHHHHHcG :Sec Str :================== :RP:SCP|25->198|1ivnA|9e-25|35.9|170/178|c.23.10.5 :====================== :BL:SWS|4->202|ESTE_VIBMI|5e-32|34.8|198/200