[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21799.1"

            "Protein of unknown function (DUF502)"
            ""

OrgPattern ---------------------------1-2-------------------------------------- --------------------------------------------------------------------------------------11----------------------111111111111111----------------211---11-11-11111111111-1-1111111111111111--------1------------------1-------111-------------------------------------------------------------------------------------------------------1----------------------1-------1-----11111-----1--11----------111111111111------------111111111111111111111111--11111-----111--------------11-----------------------------1-----111111111111-1111111111111111111111111111111111111112111111111111--12111------1-------111-1-11-------2-----------------------1----------------------------------------1---------------------------------------------------------------------------------------------1111111111---1-----------------------------------------------------1--------------11111111111111111------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------4343-41------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSIKKKKSFALRLRNYFFTGVIVLIPIGFTLYLSKFLINFSTKLVPSGLNPNTYLPYAIP:Sequence : XX:SEG|59->71|ipgieiiltiifi 61: . . . * . .: 120 :GIEIILTIIFITVVGGLSLTFIGKKFLQIIDDLFKRMPILRTIYSAIGQMTDSFRAQEGN:Sequence :XXXXXXXXXXX :SEG|59->71|ipgieiiltiifi : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|73->170|PF04367|5e-21|49.0|98/108|DUF502 121: . . + . . .: 180 :KKSVVLVEYPRKGSWAVGFATKENTGEIKAKININLVNVFVPTTPNPTSGFLLMIPKDDL:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|73->170|PF04367|5e-21|49.0|98/108|DUF502 181: . * . . . .: 240 :IYLDMTFEEASKFIVSAGTSKPKS :Sequence