[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21799.1 pubi0 AAZ21799.1 "Protein of unknown function (DUF502)"
MSIKKKKSFALRLRNYFFTGVIVLIPIGFTLYLSKFLINFSTKLVPSGLNPNTYLPYAIP
GIEIILTIIFITVVGGLSLTFIGKKFLQIIDDLFKRMPILRTIYSAIGQMTDSFRAQEGN
KKSVVLVEYPRKGSWAVGFATKENTGEIKAKININLVNVFVPTTPNPTSGFLLMIPKDDL
IYLDMTFEEASKFIVSAGTSKPKS
//