[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ21934.1"

            "SpoU rRNA Methylase family"
            ""

OrgPattern -----------------------1-------------------------------------------- 11111222222111111----1--11-----111111111111-1111211222211111111112211111111---2111-11111221111111--21111-11-1----------------1111111121111111---1112212211111111111211111221111111111111111121111222222222222222212112222222211221111112121111111111111121111121222112121122222221112211111222211222212222121111111111112122222222222121222222222222222222212221121111121221111122-21-1-11112211211111111111111111-111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111111111111111---------11111111-111111-11111111111111-111111121-12111111121111121111111111111111111-111-1------12222111111111111-11111111111111111111112222111111111111111112111111121122222222222111111111111111111111111111111111111111-1111211111111111111111111-11-111111111111111111111111111111111111111111111111122121212-21212212221211221121111111111--1 1-1111--1---111------1-1-1----------------------11----------1----------1--111-111---11-1---------------1-1--2------1-----------1-121-1-------------------1-11------2-1-----11-1-1112111-11--1-1111111-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKE:Sequence : EEcHHHHHHHHHHcGGGEEEEEEETTcccT THHHHHHHHHHcEEEEEcHHH:Sec Str : =====================================================:RP:SCP|8->80|1gz0A2|1e-05|27.7|65/76|d.79.3.3 : ======================================================:BL:SWS|7->240|TRMHL_STAAE|5e-28|30.0|230/248 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->83|PF08032|2e-07|46.4|69/77|SpoU_sub_bind 61: . . . * . .: 120 :LDKYTSKDQIMHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASS:Sequence :HHH HcTTcccTTEEEEEccccGGGEEcccEEcTTcEEEEEEccccHHHHHHHHHHHHH:Sec Str :==================== :RP:SCP|8->80|1gz0A2|1e-05|27.7|65/76|d.79.3.3 : ===================================:RP:SCP|86->239|1gz0A1|7e-36|28.6|154/166|c.116.1.1 :============================================================:BL:SWS|7->240|TRMHL_STAAE|5e-28|30.0|230/248 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->83|PF08032|2e-07|46.4|69/77|SpoU_sub_bind : $$$$$$$$$$$$$$$$$$$:RP:PFM|102->238|PF00588|6e-20|35.3|136/143|SpoU_methylase 121: . . + . . .: 180 :FHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARG:Sequence :HTcEEEEEccccccccHHHHHHTTccHHHHHTcEEEccHHHHHHHHcccGGGEEEEccTT:Sec Str :============================================================:RP:SCP|86->239|1gz0A1|7e-36|28.6|154/166|c.116.1.1 :============================================================:BL:SWS|7->240|TRMHL_STAAE|5e-28|30.0|230/248 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|102->238|PF00588|6e-20|35.3|136/143|SpoU_methylase 181: . * . . . .: 240 :EKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL:Sequence :cEEGGGccccTTcEEEEEcTTTcccHHTTccGGGEEEcccccccccccHHHHHHHHHHHH:Sec Str :=========================================================== :RP:SCP|86->239|1gz0A1|7e-36|28.6|154/166|c.116.1.1 :============================================================:BL:SWS|7->240|TRMHL_STAAE|5e-28|30.0|230/248 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|102->238|PF00588|6e-20|35.3|136/143|SpoU_methylase 241: + . . . . *: 300 :SYLKKNS :Sequence : :Sec Str