[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ22059.1"

            "Putative NADPH-quinone reductase"
            ""

OrgPattern ----------------------------------------------11--111--------------- 1---2------------------------------------11-----------------11------------------1-----11-------------1---21--------------------------------------------------------------------------------------122222122-222222-1113-222---1---------22------------------------11---1---------11-2----------111------------------------211---111--1-1-111-1-1-1-----------------------------------1--------------------1--1-------------11-1221-131-3--122122112-----12------------------1----------------------------------1----1----1111211-111111--1111--112-111--11--1-------1---------------------1-11----1--------------1----11---1-----------------------------------------------------------------------------------------------------------1-111-------------------1-------------------------------------1-111121-1111-111111111----1-3223221-112111112-------------------1----21----------------11---------------------------------------------------1- -------------------------------------------------------------------1----------------------------------------1--8B2212-12112142131662-2321211311311211-2123-1211----2--------------------1---1-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQAGEDVLD:Sequence :ccEEEEEEccccTTcHHHHHHHHHHHHHHHTTcEEEEEETTTTTccccccGGGccHHHHH:Sec Str : ===========================================================:RP:SCP|2->189|1d4aA|5e-33|25.1|183/273|c.23.5.3 : ===========================================================:BL:SWS|2->179|NQO2_RAT|6e-19|34.7|173/231 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->159|PF02525|3e-18|34.9|152/193|Flavodoxin_2 61: . . . * . .: 120 :HRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKK:Sequence :HHHHHHHccEEEEEEEccTTcccHHHHHHHHHHcccTTTccTTccTTcccGGGcTTTTcE:Sec Str :============================================================:RP:SCP|2->189|1d4aA|5e-33|25.1|183/273|c.23.5.3 :============================================================:BL:SWS|2->179|NQO2_RAT|6e-19|34.7|173/231 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->159|PF02525|3e-18|34.9|152/193|Flavodoxin_2 121: . . + . . .: 180 :AIIFCTYGSPRLAVTTFFLNLPIRRLKRGVFHMCGIYNIVYRRYFAVPFVTDEKRKEFLE:Sequence :EEEEEEccccTGGGcTTcTTccHHHHHTTTTGGGTcEEcccEEETTGGGccHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->189|1d4aA|5e-33|25.1|183/273|c.23.5.3 :=========================================================== :BL:SWS|2->179|NQO2_RAT|6e-19|34.7|173/231 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->159|PF02525|3e-18|34.9|152/193|Flavodoxin_2 181: . * . . . .: 240 :DVKKTANNI :Sequence :HHHHHHTTG :Sec Str :========= :RP:SCP|2->189|1d4aA|5e-33|25.1|183/273|c.23.5.3