[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ22091.1"

            "iron-containing alcohol dehydrogenase"
            ""

OrgPattern 11111--1--1--1-11----1-31-----1---1---1---111-11--111-1211221-12---- -11----1222----------1--14-----151112486-1-1----1---131-------1--12----21112323122211-1132241211------1-111--1---------------223321222-222222111112-11--111-----11---1111---------------1---443433223233332333333625453333263522334444531111111111111111-11--313-22-21-1223322311112111111111111122222222222-11111111111121111-11112447A666656686947GG4897564123552244469122326424223-111--------1-211---2522311111111112--16--4-2421-4553323844334-112-133133211212222223--1--12-----------------------------1-2212-65143234433222233222333325124752-1232121112244341111--121-------1--111-753C457468666-43442-6A3----22---112----1------------1-----65932-224132333335733343444463-----1-------74663415557577765-55556765555765555568A9454447756676666666666434344451-333334333333---------1111-2326333415--------233334333332133341522554313222---111-1-233354444445545-----------------4111111--------1-1------------------2------3223442334-11 --2211--21-1--1233233322422111112333222222211122233463221111111---1-1------11111------21-122322211112-2111-16121211231-1111111-1-381-23111111-111111111-1111111111-31-11127112--32281111-----3--11----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGI:Sequence : cccccccccEEEEcTTGGGGHHHHHHHTTccEEEEEccTTTcccccHHHHHHHHHHTTc:Sec Str : ====================================================:RP:SCP|9->384|1rrmA|1e-88|29.9|368/385|e.22.1.2 : =========================================================:BL:SWS|4->381|DHAT_KLEPN|8e-55|34.4|369/387 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->372|PF00465|6e-66|39.6|356/364|Fe-ADH 61: . . . * . .: 120 :IAALYSNVVGNPTGTNVNEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDF:Sequence :EEEEEccccccccHHHHHHHHHHHHHTTccEEEEEEcHHHHHHHHHHHHHHHcccccGGG:Sec Str : XXXXXXXXXXXX :SEG|67->78|nvvgnptgtnvn :============================================================:RP:SCP|9->384|1rrmA|1e-88|29.9|368/385|e.22.1.2 :============================================================:BL:SWS|4->381|DHAT_KLEPN|8e-55|34.4|369/387 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->372|PF00465|6e-66|39.6|356/364|Fe-ADH 121: . . + . . .: 180 :EDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVIL:Sequence :cccccccccccccccccEEEEEccTTccGGGccEEEEEETTTTEEEEEEcGGGcccEEEE:Sec Str : ###:PROS|178->206|PS00913|ADH_IRON_1|PDOC00059| :============================================================:RP:SCP|9->384|1rrmA|1e-88|29.9|368/385|e.22.1.2 :============================================================:BL:SWS|4->381|DHAT_KLEPN|8e-55|34.4|369/387 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->372|PF00465|6e-66|39.6|356/364|Fe-ADH 181: . * . . . .: 240 :DPILTVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGS:Sequence :cGGGTTTccHHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHHHHHHHHHHHcTT:Sec Str :########################## :PROS|178->206|PS00913|ADH_IRON_1|PDOC00059| :============================================================:RP:SCP|9->384|1rrmA|1e-88|29.9|368/385|e.22.1.2 :============================================================:BL:SWS|4->381|DHAT_KLEPN|8e-55|34.4|369/387 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->372|PF00465|6e-66|39.6|356/364|Fe-ADH 241: + . . . . *: 300 :NIEARMNMLTAASMGSTAFQKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVI:Sequence :cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHGGGc:Sec Str :============================================================:RP:SCP|9->384|1rrmA|1e-88|29.9|368/385|e.22.1.2 :============================================================:BL:SWS|4->381|DHAT_KLEPN|8e-55|34.4|369/387 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->372|PF00465|6e-66|39.6|356/364|Fe-ADH 301: . . . . + .: 360 :ENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADP:Sequence :HHHHHHHHHHTTcccTHHHHHHHHHHHHHHHTTccccGGGGccGGGTGHHHHHHHHHHcG:Sec Str :============================================================:RP:SCP|9->384|1rrmA|1e-88|29.9|368/385|e.22.1.2 :============================================================:BL:SWS|4->381|DHAT_KLEPN|8e-55|34.4|369/387 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->372|PF00465|6e-66|39.6|356/364|Fe-ADH 361: . . . * . .: 420 :STGGNPKKLTEDDMRIMYQNSMTGELFK :Sequence :GGTTccccccHHHHHHHHHHHcEEc :Sec Str :======================== :RP:SCP|9->384|1rrmA|1e-88|29.9|368/385|e.22.1.2 :===================== :BL:SWS|4->381|DHAT_KLEPN|8e-55|34.4|369/387 :$$$$$$$$$$$$ :RP:PFM|10->372|PF00465|6e-66|39.6|356/364|Fe-ADH