[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:AAZ22111.1"

            "GXGXG motif-containing protein"
            ""

OrgPattern ---1----------1----11--1--------112222323211--111-2122-1-----1------ ---------------------1---1------11111-11-1-----------1----------------------------1----------------------------------------------------------111--------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------1------------------------1------1------1-111112-----1----------1-11------1-------------11-11-11-1--11111111112111---1------1-1------------1--------------------------------2------------------------2-----------1------1--------11----2-2-------------1--------1--1111--1--111-------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------1-------------------------1------------11-1---111---------1-------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANLKNTEKKTKAQSMGMHSEVLTGRTQQKFFNPDEGENLYYFGTYDVDFNKRTELDVKD:Sequence : :Sec Str : =====:BL:SWS|56->273|GLXC_RHIME|6e-31|36.5|211/228 61: . . . * . .: 120 :MTAPEANKEIDNLMSQGFGTIVIKNPQGKHSLGVGILNKLNLIFEGSLGYFGMGSCDGPT:Sequence : ccccEEEEEEEEEEcTTTTTccTTEE:Sec Str : =====================:RP:SCP|100->212|1ea0A1|2e-20|25.0|112/270|b.80.4.1 :============================================================:BL:SWS|56->273|GLXC_RHIME|6e-31|36.5|211/228 : $$$$$$$$$$:RP:PFM|111->211|PF01493|3e-09|36.6|101/195|GXGXG 121: . . + . . .: 180 :VRINGRVGWSCAENLMAGKVVIEKNAGSCFGAAIRGGDLICKGSVGARTGIDMKGGTIIV:Sequence :EEEEEEEcccTTTTcEEEEEEEEccTTccccGTccEEEEEEcccccccTTTTccccEEEE:Sec Str :============================================================:RP:SCP|100->212|1ea0A1|2e-20|25.0|112/270|b.80.4.1 :============================================================:BL:SWS|56->273|GLXC_RHIME|6e-31|36.5|211/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|111->211|PF01493|3e-09|36.6|101/195|GXGXG 181: . * . . . .: 240 :GGDAGAFTGFMMQRGRIIILGDVGINLGDSMYDGTIFIGGKIGSFGSDAVPADLTASDQD:Sequence :cc ccccTTTTcEEEEEEEccccccccTTTc :Sec Str : XXXXXXXXXXXXXX :SEG|214->227|gtifiggkigsfgs :================================ :RP:SCP|100->212|1ea0A1|2e-20|25.0|112/270|b.80.4.1 :============================================================:BL:SWS|56->273|GLXC_RHIME|6e-31|36.5|211/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|111->211|PF01493|3e-09|36.6|101/195|GXGXG 241: + . . . . *: 300 :WLKRKLKVAEIGEKFDVSKMTKIVAGKKLWNYDNLEPHEKKGAI :Sequence : :Sec Str :================================= :BL:SWS|56->273|GLXC_RHIME|6e-31|36.5|211/228