[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ22111.1 pubi0 AAZ22111.1 "GXGXG motif-containing protein"
MANLKNTEKKTKAQSMGMHSEVLTGRTQQKFFNPDEGENLYYFGTYDVDFNKRTELDVKD
MTAPEANKEIDNLMSQGFGTIVIKNPQGKHSLGVGILNKLNLIFEGSLGYFGMGSCDGPT
VRINGRVGWSCAENLMAGKVVIEKNAGSCFGAAIRGGDLICKGSVGARTGIDMKGGTIIV
GGDAGAFTGFMMQRGRIIILGDVGINLGDSMYDGTIFIGGKIGSFGSDAVPADLTASDQD
WLKRKLKVAEIGEKFDVSKMTKIVAGKKLWNYDNLEPHEKKGAI
//