[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:acrB"

acrB        "probable integral membrane protein"
            ""

OrgPattern ----------------------------------------1--------------------------- -----------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------16-3--1---1---------------------11111111111---------1---1------13111-------------------------11---------------------------------------------------------------------------------------------2----------11-----------------11111------1-------------------------------------11----------------111--------11-----2-------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLSLFYQNIVLKNPKSIFILLLITLLSFGYFSKDFRLDASSDTLLIEGDPDLEYLKEVTE:Sequence : XXXXXXXXXXXXX :SEG|16->28|sifilllitllsf 61: . . . * . .: 120 :RYGSKEFLILTYSPNEGMVTESSINNLLSLKYKIQSLDWVHSVITLLDIPLLNNSEAPLQ:Sequence : ===============:BL:SWS|106->198|Y1893_SULSO|6e-04|36.4|88/530 121: . . + . . .: 180 :ERLESFKTLKDEGVDTERGFNEILNSPVFRNFVISEDGKTSGIIVYIKKDELKDIENKSA:Sequence :============================================================:BL:SWS|106->198|Y1893_SULSO|6e-04|36.4|88/530 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|153->356|PF03176|6e-09|23.8|185/284|MMPL 181: . * . . . .: 240 :QEIEEYKDTLKKKNHENITQIREVIKTYGDVGKIYLGGIPMITDDMMSFIKSDIIVFGLG:Sequence : ===================:RP:SCP|222->362|1iwgA7|4e-13|10.0|140/199|f.35.1.1 :================== :BL:SWS|106->198|Y1893_SULSO|6e-04|36.4|88/530 : =======:BL:SWS|234->366|DISP1_MOUSE|3e-04|28.8|125/1521 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|153->356|PF03176|6e-09|23.8|185/284|MMPL 241: + . . . . *: 300 :VLLFIIATLWFIFRKLIWIIVPISSCFFSVLIMTGLLGLLGWKVTVISSNFIALMLILTM:Sequence :============================================================:RP:SCP|222->362|1iwgA7|4e-13|10.0|140/199|f.35.1.1 :============================================================:BL:SWS|234->366|DISP1_MOUSE|3e-04|28.8|125/1521 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|153->356|PF03176|6e-09|23.8|185/284|MMPL 301: . . . . + .: 360 :AMNIHMSTRFLQLREDFPNLDNLKIIIMTTSKMFWPIIYTVLTTICAFLSLVFSGIKPII:Sequence :============================================================:RP:SCP|222->362|1iwgA7|4e-13|10.0|140/199|f.35.1.1 :============================================================:BL:SWS|234->366|DISP1_MOUSE|3e-04|28.8|125/1521 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|153->356|PF03176|6e-09|23.8|185/284|MMPL 361: . . . * . .: 420 :DFGWMMTLGLITSFIITFTLLPTLLSFMSSNKVKIKEDADSKITSFFGKISINNKSIIFL:Sequence : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|367->390|tlglitsfiitftllptllsfmss : X:SEG|420->432|lvtglvvvlsvvg :== :RP:SCP|222->362|1iwgA7|4e-13|10.0|140/199|f.35.1.1 :====== :BL:SWS|234->366|DISP1_MOUSE|3e-04|28.8|125/1521 421: . . + . . .: 480 :VTGLVVVLSVVGISKLEVENSFINYFNKNTEIYKGMKLIDEKLGGTTPLEVILKFPENII:Sequence :XXXXXXXXXXXX :SEG|420->432|lvtglvvvlsvvg 481: . * . . . .: 540 :VETTEDDEFESWDDEGSKDDEKYWFTKDKIEKIQNVHNYLDNLPAVGKVLSFSSIIEVAT:Sequence 541: + . . . . *: 600 :QLNNNKPLGTLEMGVLYSKIPETIKKDIIDPYISIKDNEARISLRIIDSQDGLRRNDLIN:Sequence 601: . . . . + .: 660 :QINYDLENELKLSKEEFKLAGVLILFNNLLQSLFKSQILTLGLVMVGIFAMFMILFRNFK:Sequence : ========================:RP:SCP|637->788|1iwgA7|3e-12|13.5|152/199|f.35.1.1 661: . . . * . .: 720 :LSLIGVVPNFIAAFFILGIIGLLGIPLDMMTITIAAITIGIAVDNSIHYIYRFKEEFLKI:Sequence : XXXXXXXXXXXXXXXX :SEG|670->685|fiaaffilgiigllgi : XXXXXXXXXXXX :SEG|691->702|titiaaitigia :============================================================:RP:SCP|637->788|1iwgA7|3e-12|13.5|152/199|f.35.1.1 : =================:BL:SWS|704->783|YDGH_BACSU|3e-04|34.6|78/885 : $$$$$$$$$$$$$$$$$$:RP:PFM|703->788|PF03176|3e-09|32.6|86/284|MMPL 721: . . + . . .: 780 :KDYNKTLKVCHSTVGVAILNTSITIVFGFSILVFSKFIPTIYFGVFTGLAMLLAMISVLT:Sequence :============================================================:RP:SCP|637->788|1iwgA7|3e-12|13.5|152/199|f.35.1.1 :============================================================:BL:SWS|704->783|YDGH_BACSU|3e-04|34.6|78/885 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|703->788|PF03176|3e-09|32.6|86/284|MMPL 781: . * . . . .: 840 :LLPSLILISKPFGK :Sequence :======== :RP:SCP|637->788|1iwgA7|3e-12|13.5|152/199|f.35.1.1 :=== :BL:SWS|704->783|YDGH_BACSU|3e-04|34.6|78/885 :$$$$$$$$ :RP:PFM|703->788|PF03176|3e-09|32.6|86/284|MMPL