[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21520.1 pubi0 acrB "probable integral membrane protein"
MLSLFYQNIVLKNPKSIFILLLITLLSFGYFSKDFRLDASSDTLLIEGDPDLEYLKEVTE
RYGSKEFLILTYSPNEGMVTESSINNLLSLKYKIQSLDWVHSVITLLDIPLLNNSEAPLQ
ERLESFKTLKDEGVDTERGFNEILNSPVFRNFVISEDGKTSGIIVYIKKDELKDIENKSA
QEIEEYKDTLKKKNHENITQIREVIKTYGDVGKIYLGGIPMITDDMMSFIKSDIIVFGLG
VLLFIIATLWFIFRKLIWIIVPISSCFFSVLIMTGLLGLLGWKVTVISSNFIALMLILTM
AMNIHMSTRFLQLREDFPNLDNLKIIIMTTSKMFWPIIYTVLTTICAFLSLVFSGIKPII
DFGWMMTLGLITSFIITFTLLPTLLSFMSSNKVKIKEDADSKITSFFGKISINNKSIIFL
VTGLVVVLSVVGISKLEVENSFINYFNKNTEIYKGMKLIDEKLGGTTPLEVILKFPENII
VETTEDDEFESWDDEGSKDDEKYWFTKDKIEKIQNVHNYLDNLPAVGKVLSFSSIIEVAT
QLNNNKPLGTLEMGVLYSKIPETIKKDIIDPYISIKDNEARISLRIIDSQDGLRRNDLIN
QINYDLENELKLSKEEFKLAGVLILFNNLLQSLFKSQILTLGLVMVGIFAMFMILFRNFK
LSLIGVVPNFIAAFFILGIIGLLGIPLDMMTITIAAITIGIAVDNSIHYIYRFKEEFLKI
KDYNKTLKVCHSTVGVAILNTSITIVFGFSILVFSKFIPTIYFGVFTGLAMLLAMISVLT
LLPSLILISKPFGK
//