[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:argH"

argH        "Argininosuccinate lyase"
ARLY_PELUB  "RecName: Full=Argininosuccinate lyase;         Short=ASAL;         EC=4.3.2.1;AltName: Full=Arginosuccinase;"

OrgPattern ---1-11333322313-1111111111111111111111111111111111111121-11121-1-11 1111111111111111111-11111111111111111111111111211111111112--113121111111111111--11121122111111---111-1-1111111----------1111-12111111111111112221111112221122111111121122111111111121112111111-22266666645345565543333355422232222222225211111111111111111111---11211--1222222-2-11-2221111-11121-22--11--1--------------122222212221-2211111111111111111-1211-3112122221-22211122--11111111111-2-11111111111111111111112-1111111262111221111111223411112122121111111111111111111---1111111--1---11111-11-----211111122122111121222211114444421212313121111121111311211111111111111111111111211111111111122122212121111111111211111111-1-------1111111111111111111111111111111111111---111111111111211111111111111-1111211111111111111111111111111111111111111111111111-111111111111---1-----111111111111111111111111111111111121111111211111111111--------121111111111111111111111111111111111111----------------------------1--------12--12-11111 ------1-----1111111111111111111-11111111111111111112132211111111111111111111111112111111-11111111111111121-12-2131123111111111-217B4-413---111111----11111152-212-121112112--11111181111131221111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVKNKNNMAIWGSRIKKDASTLFQKVGNSIDIDKKLFQEDILGSIAHVEMLFRQKIISFK:Sequence : GGGccTTccccHHHHHHHHHHHccHHHHGGGHHHHHHHHHHHHHHHHHTTcccHH:Sec Str : XXXXXX:SEG|55->67|kiisfkiknkiif : ================================:RP:SCP|29->461|1aosA|8e-83|34.1|422/434|a.127.1.1 :============================================================:BL:SWS|1->462|ARLY_PELUB|0.0|100.0|462/462 61: . . . * . .: 120 :IKNKIIFGLNKIEKEILKNKFEYNKKYEDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVI:Sequence :HHHHHHHHHHHHHHHHTTTcccccGGGccHHHHHHHHHHHHccTTGGGTTTTccHHHHHH:Sec Str :XXXXXXX :SEG|55->67|kiisfkiknkiif :============================================================:RP:SCP|29->461|1aosA|8e-83|34.1|422/434|a.127.1.1 :============================================================:BL:SWS|1->462|ARLY_PELUB|0.0|100.0|462/462 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->300|PF00206|2e-19|29.7|212/302|Lyase_1 121: . . + . . .: 180 :TDFKMWTTSATKEINKNLDNIIKTILKISEKNIETIMPGFTHLKNAQAVSFAHYLMSYVE:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTcEEEEEETTEEEEEEEHHHHHHHHHH:Sec Str :============================================================:RP:SCP|29->461|1aosA|8e-83|34.1|422/434|a.127.1.1 :============================================================:BL:SWS|1->462|ARLY_PELUB|0.0|100.0|462/462 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->300|PF00206|2e-19|29.7|212/302|Lyase_1 181: . * . . . .: 240 :MFNRDKKRFTYNLESLSENPLGVAALTGTSFNIDRNFTSKKLGFKRPTNNSIDTVADRDF:Sequence :HHHHHHHHHHHHHHHHcEEcTTcTTcccccccccHHHHHHHTTccEEcccHHHHHHccHH:Sec Str :============================================================:RP:SCP|29->461|1aosA|8e-83|34.1|422/434|a.127.1.1 :============================================================:BL:SWS|1->462|ARLY_PELUB|0.0|100.0|462/462 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->300|PF00206|2e-19|29.7|212/302|Lyase_1 241: + . . . . *: 300 :VLDFLYSASVCSMHISRIAEELIIWNSDGFNLITLSDKVVTGSSIMPQKKNPDLLEYLRG:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHTcTTTccEEccGGGccccTTcccccccHHHHHHHH:Sec Str : ########## :PROS|282->291|PS00163|FUMARATE_LYASES|PDOC00147| :============================================================:RP:SCP|29->461|1aosA|8e-83|34.1|422/434|a.127.1.1 :============================================================:BL:SWS|1->462|ARLY_PELUB|0.0|100.0|462/462 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->300|PF00206|2e-19|29.7|212/302|Lyase_1 301: . . . . + .: 360 :KTGTVYGNLFSMLTILKGLPISYFKDLQDDKEILFKSNEILNNSIAILNEVLKNLKPNKQ:Sequence :THHHHHHHHHHHHHHHTTccccccGGGGGGHHHHHHHHHHHHHHHHHHHHHGGGcEEcHH:Sec Str :============================================================:RP:SCP|29->461|1aosA|8e-83|34.1|422/434|a.127.1.1 :============================================================:BL:SWS|1->462|ARLY_PELUB|0.0|100.0|462/462 361: . . . * . .: 420 :QMLDLANSGYITATDLADYLVKNHSMPFRKAYQTTASIVNYAEKKKKKLNELNIDELKKI:Sequence :HHHHHHccccTTHHHHHHHHHHTHTccHHHHHHHHHHHHHHHHHTTccGGGccHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXX :SEG|403->419|ekkkkklnelnidelkk :============================================================:RP:SCP|29->461|1aosA|8e-83|34.1|422/434|a.127.1.1 :============================================================:BL:SWS|1->462|ARLY_PELUB|0.0|100.0|462/462 421: . . + . . .: 480 :EPRLTIEVLKIFNVKNSVNSKKSYGGTSFDNIKKMIMKYKKT :Sequence :cTTccGGGGGGccHHHHTTccccTTcccHHHHHHHHHHHHH :Sec Str :========================================= :RP:SCP|29->461|1aosA|8e-83|34.1|422/434|a.127.1.1 :========================================== :BL:SWS|1->462|ARLY_PELUB|0.0|100.0|462/462