[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:atpF"

atpF        "H+-transporting two-sector ATPase (subunit b)"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------1------------------------------------1--------1---1-------------------------------1-------------1----1----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDN:Sequence : =========================================================:BL:SWS|4->150|ATPF_RHORU|1e-14|27.4|146/182 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->136|PF00430|7e-10|34.1|129/132|ATP-synt_B 61: . . . * . .: 120 :AQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEI:Sequence :============================================================:BL:SWS|4->150|ATPF_RHORU|1e-14|27.4|146/182 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->136|PF00430|7e-10|34.1|129/132|ATP-synt_B 121: . . + . . .: 180 :KDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNLEETKIALKKISS :Sequence :============================== :BL:SWS|4->150|ATPF_RHORU|1e-14|27.4|146/182 :$$$$$$$$$$$$$$$$ :RP:PFM|7->136|PF00430|7e-10|34.1|129/132|ATP-synt_B