[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ20943.1 pubi0 atpF "H+-transporting two-sector ATPase (subunit b)"
MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDN
AQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEI
KDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNLEETKIALKKISS
//