[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:carD"

carD        "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -1-1-1-111111111111-11111111111111111111-------1-11----11-------11-11111111111-------------------------------------------------------------------------------------------------------------------1-------1-----1-1----1--2---------------------------------------------------------------------------------------------------------1-1------------1---------11-1--111111111111---1------111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111----------111111111111111----111111-----------------------------------------------------------------------11111111111111--------1-11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKTSTTNILAKIFKKTPEKKVKKKTKAKVAKKPTLPKAKVVKKKIPVKKTKTIKATPTK:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|12->63|kifkktpekkvkkktkakvakkptlpkakvvkkkipvkktktikatptkikk 61: . . . * . .: 120 :IKKNLKTVSKKAVPEKVEIKTDNLRISKSNEVKPEIKKVKKQETEKREYKVKDYVVYPKH:Sequence :XXX :SEG|12->63|kifkktpekkvkkktkakvakkptlpkakvvkkkipvkktktikatptkikk : ============:BL:SWS|109->251|YDEB_BACSU|3e-11|26.8|142/153 : $$$$$$$$$$$$:RP:PFM|109->158|PF02559|3e-06|44.0|50/100|CarD_TRCF 121: . . + . . .: 180 :GVGQITEFKKINIGGIDVETYVLKFEKDKANGMVPVNKQSHLRPLATINQVNKCISILKS:Sequence :============================================================:BL:SWS|109->251|YDEB_BACSU|3e-11|26.8|142/153 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|109->158|PF02559|3e-06|44.0|50/100|CarD_TRCF : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|154->241|PF05889|5e-05|33.7|83/388|SLA_LP_auto_ag 181: . * . . . .: 240 :KPKIKRSMWSRRAQEYEAKISSGKIYELAEVVRDLNKGDDLMVDQSYSERQLFEKAYERI:Sequence :============================================================:BL:SWS|109->251|YDEB_BACSU|3e-11|26.8|142/153 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|154->241|PF05889|5e-05|33.7|83/388|SLA_LP_auto_ag 241: + . . . . *: 300 :LSEFQIVMGISLEDTQKKLDKALKRNLEGQAKAVAAPTKIKEPITESDTDSEPITDTED :Sequence :=========== :BL:SWS|109->251|YDEB_BACSU|3e-11|26.8|142/153 :$ :RP:PFM|154->241|PF05889|5e-05|33.7|83/388|SLA_LP_auto_ag