[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21245.1 pubi0 carD "hypothetical protein"
MKKTSTTNILAKIFKKTPEKKVKKKTKAKVAKKPTLPKAKVVKKKIPVKKTKTIKATPTK
IKKNLKTVSKKAVPEKVEIKTDNLRISKSNEVKPEIKKVKKQETEKREYKVKDYVVYPKH
GVGQITEFKKINIGGIDVETYVLKFEKDKANGMVPVNKQSHLRPLATINQVNKCISILKS
KPKIKRSMWSRRAQEYEAKISSGKIYELAEVVRDLNKGDDLMVDQSYSERQLFEKAYERI
LSEFQIVMGISLEDTQKKLDKALKRNLEGQAKAVAAPTKIKEPITESDTDSEPITDTED
//