[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:ddlB"

ddlB        "D-alanine--D-alanine ligase B"
DDL_PELUB   "RecName: Full=D-alanine--D-alanine ligase;         EC=6.3.2.4;AltName: Full=D-alanylalanine synthetase;AltName: Full=D-Ala-D-Ala ligase;"

OrgPattern ----------------------------------------------1-----1--------------1 121-3111---21111111-111111111111-111111121131211233111111111223222212121111111221121121111111111---11111111--111111111-1-----111111111211111111111-1111111111111111111111-1111111111111111111111111121222212222221111112221112111111111331111111111111111111121111111-1-111111111111111111111111111111121111111111111111111111111111421111111111111211122132111112112211111111111111111-211111111115221111111122222222221-11-111111211211122222211111111131111111111111111111111111--------1111111111111111111111111111111111111111111111111112111111111111111111111111111112111111111111111121111111111-111111111122223222111-111111-11--1--11-1111111111111111212111111111111111111-1111111----22112212222222222-2222222222222122222222111112221222222222212222222221121111111111111111111111111121111111111111111111111111111122221212121331222111-111111111211111111112212222222111111112211111111111111--------------------------1212213112121 -----------------------1-1---------------------------------111-----------------------------------------------------------------------------------------------------1---------1-----------2--1--1------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFN:Sequence :ccEEEEEEEEcccTTHHHHHHHHHHHHHHccTTTEEEEEEEEcTTccEEEEcGGGcEEEE:Sec Str :============================================================:RP:SCP|1->96|1iovA1|2e-20|41.7|96/96|c.30.1.2 :============================================================:BL:SWS|1->304|DDL_PELUB|e-158|100.0|304/304 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->86|PF01820|5e-10|45.8|83/108|Dala_Dala_lig_N 61: . . . * . .: 120 :ALHGQFGEDGYIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYIKFNHK:Sequence :EEccHHHHccHHHHHHHHTTcccccccHHHHHHHHcHHHHHHHHHHTTcccccEEEEEHH:Sec Str : XXXXXX:SEG|115->135|ikfnhkknklniiklieknlk : ############ :PROS|63->74|PS00843|DALA_DALA_LIGASE_1|PDOC00659| :==================================== :RP:SCP|1->96|1iovA1|2e-20|41.7|96/96|c.30.1.2 : =========================:RP:SCP|96->300|1e4eA2|1e-35|27.3|198/211|d.142.1.1 :============================================================:BL:SWS|1->304|DDL_PELUB|e-158|100.0|304/304 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->86|PF01820|5e-10|45.8|83/108|Dala_Dala_lig_N 121: . . + . . .: 180 :KNKLNIIKLIEKNLKFPVVVKPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPG:Sequence :HHTTccHHHHHHHHcccEEEEEccccccTTcEEEccGGGHHHHHHTTTccEEEEEEcccc:Sec Str :XXXXXXXXXXXXXXX :SEG|115->135|ikfnhkknklniiklieknlk :============================================================:RP:SCP|96->300|1e4eA2|1e-35|27.3|198/211|d.142.1.1 :============================================================:BL:SWS|1->304|DDL_PELUB|e-158|100.0|304/304 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|136->298|PF07478|1e-28|44.4|162/199|Dala_Dala_lig_C 181: . * . . . .: 240 :REIQVAIMNNKSLGAIELEPRRKFYDYEAKYNSSAKTKHLIPVDLSKNNLAKITGIARAA:Sequence :EEEEEEEEcccccEEEEEEEEEccccHHHHTTccTcccEEccccccHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|96->300|1e4eA2|1e-35|27.3|198/211|d.142.1.1 :============================================================:BL:SWS|1->304|DDL_PELUB|e-158|100.0|304/304 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|136->298|PF07478|1e-28|44.4|162/199|Dala_Dala_lig_C 241: + . . . . *: 300 :HKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLSLVPEIAKHKGISFIKLIEWILKDA:Sequence :HHHHTcccEEEEEEEEcTccEEEEEEEccccccTTcHHHHHHHTTTccHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|96->300|1e4eA2|1e-35|27.3|198/211|d.142.1.1 :============================================================:BL:SWS|1->304|DDL_PELUB|e-158|100.0|304/304 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|136->298|PF07478|1e-28|44.4|162/199|Dala_Dala_lig_C 301: . . . . + .: 360 :SINR :Sequence :cHTc :Sec Str :==== :BL:SWS|1->304|DDL_PELUB|e-158|100.0|304/304