[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:dxs"

dxs         "1-D-deoxyxylulose 5-phosphate synthase"
DXS_PELUB   "RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;         EC=2.2.1.7;AltName: Full=1-deoxyxylulose-5-phosphate synthase;         Short=DXP synthase;         Short=DXPS;"

OrgPattern 22-1--1132223231-112111------1-----11111111-----------11-1111112--11 122151111111-121122-2111232122211111246322332122111163311211213232544111111111522231112222231111112234443334262222222121222222212222223213311111132221223112222222222113311322123222122111111112222222222222222223333322213442122233322331222222222222221221-12--11-31-2222221-11---3222221122-11111111111111111111111111-11111222221225444444454624222222113--1252222322212224322434131111121121124443233323322222222223-443446433321433123334343251113214344412444444443442222211122111----11---111111111-1123472322121422122222223323222212113121111221211112122221121111121111111111111121211111131111344333334112121121112111111111111111111221221122213221124222223222222222231--31111--11121222311111111111-111111111111111111333321111322222222222222211111111112212222222221111-----11111121111122111111111122222111113111111122111221221111111111-11111111111111111111111111111132333344--------11------------1---1--1------1312223232211 22--22--621---11111-11-1-112211111---------111---12222111111111-1----1---11---------11-1----1--1-------211-14225731313-1234244272Ee4-644131142362-21124213-212311-1132-622B11413221T2222343891641211112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQNYKFLKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALH:Sequence :HHHHHTGcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHH:Sec Str : #################### :PROS|32->51|PS00801|TRANSKETOLASE_1|PDOC00635| : ================================================:RP:SCP|13->254|1um9A|5e-28|15.8|228/331|c.36.1.11 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->299|PF00456|2e-12|34.4|227/275|Transketolase_N 61: . . . * . .: 120 :YVFDTPNDRLIWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSS:Sequence :HTccTTccEEEEccGGGHHHHHHHTTcHHHHTTTTcTTccccccccTTcTTcccccccTT:Sec Str :============================================================:RP:SCP|13->254|1um9A|5e-28|15.8|228/331|c.36.1.11 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->299|PF00456|2e-12|34.4|227/275|Transketolase_N 121: . . + . . .: 180 :TSISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMS:Sequence :HHHHHHHHHHHHHHHHHHHHcEEEEEcHHHHHcHHHHHHHHHHHHTTcTTEEEEEEccEE:Sec Str :============================================================:RP:SCP|13->254|1um9A|5e-28|15.8|228/331|c.36.1.11 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->299|PF00456|2e-12|34.4|227/275|Transketolase_N 181: . * . . . .: 240 :IAKPVGAMRTYLAKLLTGKIYFSLRETFKLIVSAFSKRFSVKAGKAEDFLRSAVTGGTLF:Sequence :TTEEGGTccccHHHHHHHHTcEEEETcHHHHHHHHHHHTTcTTccEEEEEEccTTTTcTT:Sec Str :============================================================:RP:SCP|13->254|1um9A|5e-28|15.8|228/331|c.36.1.11 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->299|PF00456|2e-12|34.4|227/275|Transketolase_N 241: + . . . . *: 300 :NSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAEKASDHYHGV:Sequence :TTcGGGTcccccHHHHHHHHHHTTccTTcccEccccHHHHHHHHHHTHHHHHHHHHHHHc:Sec Str :============== :RP:SCP|13->254|1um9A|5e-28|15.8|228/331|c.36.1.11 : =====================================================:RP:SCP|248->475|2apjA1|5e-45|14.7|204/244|c.23.10.7 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|27->299|PF00456|2e-12|34.4|227/275|Transketolase_N 301: . . . . + .: 360 :SKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGMDIFAKDFPK:Sequence :cTTGGGGcccccTTcccEEHHHHHHHHHHHHTTTcTTEEEEEcccHHHHTcGGccEETTc:Sec Str :============================================================:RP:SCP|248->475|2apjA1|5e-45|14.7|204/244|c.23.10.7 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|319->477|PF02779|7e-17|38.3|154/172|Transket_pyr 361: . . . * . .: 420 :RMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRA:Sequence :cEEEccccHHHHHHHHHHHHHHcTTcEEEEEHHHHGGGHHHHHHHHHHTcccEEEEEccc:Sec Str :============================================================:RP:SCP|248->475|2apjA1|5e-45|14.7|204/244|c.23.10.7 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|319->477|PF02779|7e-17|38.3|154/172|Transket_pyr 421: . . + . . .: 480 :GLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNG:Sequence :GGGcTTcTTcccccHHHHHTcccccEEEccccHHHHHHHHHHHHHcccccEEEEccccEE:Sec Str :======================================================= :RP:SCP|248->475|2apjA1|5e-45|14.7|204/244|c.23.10.7 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|319->477|PF02779|7e-17|38.3|154/172|Transket_pyr 481: . * . . . .: 540 :IGVELPSIDENIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFA:Sequence :cccTTccHHHHTTccEEEEccccccEEEEEcTTHHHHHHHHHHHHHHTTccEEEEEcccH:Sec Str : =========================================================:RP:SCP|484->636|1ay0A3|9e-21|13.9|137/146|c.48.1.1 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|499->584|PF02780|6e-14|42.4|85/122|Transketolase_C 541: + . . . . *: 600 :KPLDQELILKCAREHEAMITVEEGSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIE:Sequence :HHHHTccHHHHHHTTccEEEEcccccGGGGGTccEEEccHcTTTcccccEEEEEcccccc:Sec Str :============================================================:RP:SCP|484->636|1ay0A3|9e-21|13.9|137/146|c.48.1.1 :============================================================:BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|499->584|PF02780|6e-14|42.4|85/122|Transketolase_C 601: . . . . + .: 660 :QDSPKKMYDVAGLNASQISKKILDILFTKESIKVVKN :Sequence :cccHHHHHHHHTccHHHHHHHHHHHHHHHTTcccccT :Sec Str :==================================== :RP:SCP|484->636|1ay0A3|9e-21|13.9|137/146|c.48.1.1 :===================================== :BL:SWS|1->637|DXS_PELUB|0.0|100.0|637/637