[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:fbaB"

fbaB        "fructose-bisphosphate aldolase"
            ""

OrgPattern -------------------------------------------------------------------- ---1----------------------------------------------------------1-------------------1--------------------------1---------------1--1---1--1----------1--1--------1-1---------1--11-1-111-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-1-111111111----------1---------111111111111111111--1-------------------------------------------------------1-------------------------------1-1111-------------1-1----1-------------11-----1------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------1111----1--------------------------------------------------------------------11111111111111----------------------------------------------------------- 111111--311-111----------------------------------------------------------------------------1--------------11611474454338433389393CT5-64A3332A33333332432385213325231113712523112442j3333496JA-A31-----3 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSELNKIALKILSNGKGILAADESNGTMTKRLESVNVPSSPENRLLFRETLFSSSGMKDF:Sequence :HHHHHHHHHHHTcTTcEEEEEcccTTHHHHHHHTTTccccHHHHHHHHHHHHHcTTHHHH:Sec Str : ==========================================================:RP:SCP|3->329|1a5cA|5e-67|43.7|327/342|c.1.10.1 :============================================================:BL:SWS|1->329|ALF1_XYLFT|4e-87|47.7|329/334 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->331|PF00274|2e-87|50.0|328/329|Glycolytic 61: . . . * . .: 120 :IGGVILYDETINQTSNLKQTIPELISESGAVPGIKVDTGAKILAGSHEEKITEGLDGLRE:Sequence :EEEEEEcHHHHHcccTTcccHHHHHHHTTcEEEEEcccEEEEcTTccccEEEEcTTTHHH:Sec Str :============================================================:RP:SCP|3->329|1a5cA|5e-67|43.7|327/342|c.1.10.1 :============================================================:BL:SWS|1->329|ALF1_XYLFT|4e-87|47.7|329/334 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->331|PF00274|2e-87|50.0|328/329|Glycolytic 121: . . + . . .: 180 :RLKDYYKLGARFTKWRGVFNISDKYPSKLSIHSNAHALARYSALVQECGMVPIVEPEVLM:Sequence :HHHHHHHHTccEEEEEEEEEccTTcccHHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEc:Sec Str :============================================================:RP:SCP|3->329|1a5cA|5e-67|43.7|327/342|c.1.10.1 :============================================================:BL:SWS|1->329|ALF1_XYLFT|4e-87|47.7|329/334 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->331|PF00274|2e-87|50.0|328/329|Glycolytic 181: . * . . . .: 240 :DGDHAAETCFNKTSEVIQKCFEELLLHKIDLSGIILKPNMILAGTTSDKKISSEEVAKLT:Sequence :cccccHHHHHHHHHHHHHHHHHHHHHHTccGGGcEEccccccccTTccccccHHHHHHHH:Sec Str :============================================================:RP:SCP|3->329|1a5cA|5e-67|43.7|327/342|c.1.10.1 :============================================================:BL:SWS|1->329|ALF1_XYLFT|4e-87|47.7|329/334 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->331|PF00274|2e-87|50.0|328/329|Glycolytic 241: + . . . . *: 300 :LKCLKENVPTDVPGIAFLSGGQTEVEATENLNLINKYNDTNFIMTYSYGRALQQSALKFW:Sequence :HHHHHTTccTTccEEEEccTTccHHHHHHHHHHHHTccccccEEEEcccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|3->329|1a5cA|5e-67|43.7|327/342|c.1.10.1 :============================================================:BL:SWS|1->329|ALF1_XYLFT|4e-87|47.7|329/334 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->331|PF00274|2e-87|50.0|328/329|Glycolytic 301: . . . . + .: 360 :SKDINNTSGTQKVFNHRANMCTLAAQGKWSKELEAK :Sequence :TTcGGGHHHHHHHHHHHHHHHHHHHTTcccccccc :Sec Str :============================= :RP:SCP|3->329|1a5cA|5e-67|43.7|327/342|c.1.10.1 :============================= :BL:SWS|1->329|ALF1_XYLFT|4e-87|47.7|329/334 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->331|PF00274|2e-87|50.0|328/329|Glycolytic