[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:folE"

folE        "GTP cyclohydrolase I"
GCH1_PELUB  "RecName: Full=GTP cyclohydrolase 1;         EC=3.5.4.16;AltName: Full=GTP cyclohydrolase I;         Short=GTP-CH-I;"

OrgPattern ---1-11111111111-111111-1--1--------------------------------------11 1111211111111111111-1111211111121111213322211111111111111111113111211111---111111211111111111111---11122413111--------------1111111111111111111111322122211111111112111221211211111111111111--12111111111111111111111111111111---11111111--------------------1--1--11-1-1111--1--1--111111111111111111111111111111111111111111-1111-1-111111111-1-111111111-1-111-11221111--11111--11111211311111121221121111211111111111111111311111111111112111111111----------11111111111112121121111111--1111111111111----1131111----1111212323322113333-11211111-1--1111111111111112---2----------111-1-----------------------111111--1111111111111111111111111--1111113-11-11111121111111121111--11-11-----11111111111111111-1111111111111111111111111211111111111111111111111111111111111111111111111111111-11111111111111-11111111111111122222322221222222111111111-1111111111121111111111111111----111111-----------------------------------------------1- 11--11--1---111221112112122111111111211111111-2111121211221111111111111111111-1111111111-11121111111111111-1113143411111111111131494-312111111111111111111111222211111-32151121111-F1111121221211121111 -------------------1-----------------------------------------------------------------------------------------------------1-----------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLVEDTDSKILDTKKVSDKEAEEAFKTILTWMGEDPSREGLLETPKRVVKAFKEYFGGY:Sequence : cccccccHHHHHHHHHHHHHHHHHHTTccTTcTTGGGHHHHHHHHHHHTTTGG:Sec Str : ===============================================:RP:SCP|14->200|1a8rA|4e-63|34.9|186/221|d.96.1.1 :============================================================:BL:SWS|1->202|GCH1_PELUB|e-113|100.0|202/202 61: . . . * . .: 120 :TEDAEKILEKTFGDVEGYDDMVVEKNISVSSHCEHHMAPIVGTAHVAYIPNERVVGLSKL:Sequence :GcGGGcccccEEEcTTcccccEEEEEEEEEEEETTTccEEEEEEEEEEccccEEEcHHHH:Sec Str : ################# :PROS|80->96|PS00859|GTP_CYCLOHYDROL_1_1|PDOC00672| :============================================================:RP:SCP|14->200|1a8rA|4e-63|34.9|186/221|d.96.1.1 :============================================================:BL:SWS|1->202|GCH1_PELUB|e-113|100.0|202/202 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->180|PF01227|3e-25|59.8|82/86|GTP_cyclohydroI 121: . . + . . .: 180 :ARVVEVFSKRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTN:Sequence :HHHHHHHHccEEcHHHHHHHHHHHHHHHHTcccEEEEEEEEEHHHHccTTccccccEEEE:Sec Str : ########### :PROS|128->138|PS00860|GTP_CYCLOHYDROL_1_2|PDOC00672| :============================================================:RP:SCP|14->200|1a8rA|4e-63|34.9|186/221|d.96.1.1 :============================================================:BL:SWS|1->202|GCH1_PELUB|e-113|100.0|202/202 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->180|PF01227|3e-25|59.8|82/86|GTP_cyclohydroI 181: . * . . . .: 240 :YFLGEFKKDLSVQNRYLRFISK :Sequence :EEcTHHHHcHHHHHHHHHHccc :Sec Str :==================== :RP:SCP|14->200|1a8rA|4e-63|34.9|186/221|d.96.1.1 :====================== :BL:SWS|1->202|GCH1_PELUB|e-113|100.0|202/202