[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:gidB"

gidB        "Glucose inhibited division protein"
RSMG_PELUB  "RecName: Full=Ribosomal RNA small subunit methyltransferase G;         EC=2.1.1.-;AltName: Full=16S rRNA 7-methylguanosine methyltransferase;         Short=16S rRNA m7G methyltransferase;"

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-----------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEEIFKNYPLLKNQNVPRETLIEFDLFISMLQEENEKINIISKETAKNEVIRERHIVDSA:Sequence : XXXXXXXXXXXX :SEG|33->44|eenekiniiske : =============:RP:SCP|48->189|1jsxA|8e-07|21.1|133/193|c.66.1.20 :============================================================:BL:SWS|1->202|RSMG_PELUB|6e-94|100.0|202/213 61: . . . * . .: 120 :QIIEFVDLNSNIITDIGSGGGMPGIIISIMIKNQKNLAKVHLYEKSHHKSSFLRKVSRDL:Sequence : XXXXXXXXXXXXXXXX :SEG|76->91|igsgggmpgiiisimi :============================================================:RP:SCP|48->189|1jsxA|8e-07|21.1|133/193|c.66.1.20 :============================================================:BL:SWS|1->202|RSMG_PELUB|6e-94|100.0|202/213 121: . . + . . .: 180 :KLNTEVMQENIFEAEKLDSGTIMARAFKPLPIILDLVYKNFNSYKNLIVFMGKNGEKVLE:Sequence :============================================================:RP:SCP|48->189|1jsxA|8e-07|21.1|133/193|c.66.1.20 :============================================================:BL:SWS|1->202|RSMG_PELUB|6e-94|100.0|202/213 181: . * . . . .: 240 :ETLMNWDFDFEKKKSITSEDSFLLNIKKIKKKN :Sequence : XXXXXXXXXX :SEG|203->212|llnikkikkk :========= :RP:SCP|48->189|1jsxA|8e-07|21.1|133/193|c.66.1.20 :====================== :BL:SWS|1->202|RSMG_PELUB|6e-94|100.0|202/213