[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21174.1 pubi0 gidB "Glucose inhibited division protein"
MEEIFKNYPLLKNQNVPRETLIEFDLFISMLQEENEKINIISKETAKNEVIRERHIVDSA
QIIEFVDLNSNIITDIGSGGGMPGIIISIMIKNQKNLAKVHLYEKSHHKSSFLRKVSRDL
KLNTEVMQENIFEAEKLDSGTIMARAFKPLPIILDLVYKNFNSYKNLIVFMGKNGEKVLE
ETLMNWDFDFEKKKSITSEDSFLLNIKKIKKKN
//