[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:glcE"

glcE        "(S)-2-hydroxy-acid oxidase"
            ""

OrgPattern -------1-11111-1--221112------------------------12111----------1---- --112---------11111-1111212222211111-331-1-1----------------111-133------------1-11111----------------1---------------------------------33312----11111111111111-11111111111---------------11---11111111111111111133111111122213--------2------------------------1-------11--11------------------------------------------------------2--2-----1-2-2-1221---2--1-1--2-231111--22--1--1-121---1-----11211111212221111111-111-11111211122-11111131112221---11211112221111111121121-12-----------------------------1--4--111114333342222233452222223342222-122233222223224112211--2-------222332-1411213222222-212112212111121-31--1111111111111111111-1122----2----------------------------2112-------------1---1-1111--111111111-1111111--------------------------------------------------1---------2-211----------------------1111-11111111112121111------------------------11111111111111--1-111111----------1--------------------------11---1---2-- ----22-------1-------1-1-11------------------------11----1-111------11-2-1----1-1---1-----------------------2----------------------------------------------------------------------------3--4-3---22321 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKNSQIFQDSNNTYYPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSM:Sequence : EccccHHHHHHHHHHHHHHTccEEEEccccccTTTTTTccccTEEc:Sec Str : ==============================================:RP:SCP|15->193|1fiqB2|1e-18|8.3|168/191|d.145.1.3 : ==================================:BL:SWS|27->419|GLCE_ECOLI|3e-26|30.1|332/350 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->157|PF01565|1e-07|24.8|133/139|FAD_binding_4 61: . . . * . .: 120 :SKLSGVIEYLPEELYIKVKANTPLELVEKELEKNNQELAFEPIDFGFIENGKSNKGTIAG:Sequence :TTTccEEEEETTTTEEEEcTTccHHHHHHHHHTTTGGGTEEcTTEEEccccccccccccH:Sec Str : XXXXXXXXXXXXXXX :SEG|84->98|lelvekeleknnqel :============================================================:RP:SCP|15->193|1fiqB2|1e-18|8.3|168/191|d.145.1.3 :============================================================:BL:SWS|27->419|GLCE_ECOLI|3e-26|30.1|332/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->157|PF01565|1e-07|24.8|133/139|FAD_binding_4 121: . . + . . .: 180 :HLACNFAGSRRFKVGSLRDHILGFRGVNGKGDIIKSGGTVVKNVTGYDLSKLVTGSFGTL:Sequence :HHHHHHTcccccTTccTGGGEEEEEEEcTTccEEETTTccTTTcccccGccGGGGccccc:Sec Str :============================================================:RP:SCP|15->193|1fiqB2|1e-18|8.3|168/191|d.145.1.3 :============================================================:BL:SWS|27->419|GLCE_ECOLI|3e-26|30.1|332/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->157|PF01565|1e-07|24.8|133/139|FAD_binding_4 181: . * . . . .: 240 :VALTEITLKVLPKKKLSNTITIHTDDKKLVKNLFDKISSSSSEVSGAVYIPEEPKDENYD:Sequence :cEEEEEEEEcEEccccEEEEEEEEccTTHHHHHHHHHHHHHHHTcccTTTccccccccHH:Sec Str : XXXXX :SEG|218->222|sssss :============= :RP:SCP|15->193|1fiqB2|1e-18|8.3|168/191|d.145.1.3 :============================================================:BL:SWS|27->419|GLCE_ECOLI|3e-26|30.1|332/350 241: + . . . . *: 300 :QNKEMVFKFNDLKYKGSFLALRIEGDKIAIDEKIKALTNELELSKLNTTVLDVHQSTPFW:Sequence :HHHHHHHHHHHHTcccEEEEEEEEccHHHHHHHHHHHHHHGGGcTTcEEEcGGcccccHH:Sec Str :============================================================:BL:SWS|27->419|GLCE_ECOLI|3e-26|30.1|332/350 301: . . . . + .: 360 :KKINNLELFKQTKNNLLRVVVPPSKGPKLIQFLGNKYKYYIDWCGSLYWIEVQSKKNSKV:Sequence :HGGGGcccccEEEEEccEEcccHHHHHHHHHHHHHHTTcccccEEEEcccHHHHHHHHHH:Sec Str : ============================================:RP:SCP|317->420|1f0xA1|3e-09|11.7|94/237|d.58.32.2 :============================================================:BL:SWS|27->419|GLCE_ECOLI|3e-26|30.1|332/350 361: . . . * . .: 420 :SDIKKLTKELGGYLTIIKTSDEYDYEETIFTVDDIRLLISEKIKKSFDPKRIFNPGKMYR:Sequence :HHHHHHHHHTTcccccccGHHHHHHHccHHHHHHHHHHHcHHHHHHHcTTccccTTGGGc:Sec Str :============================================================:RP:SCP|317->420|1f0xA1|3e-09|11.7|94/237|d.58.32.2 :=========================================================== :BL:SWS|27->419|GLCE_ECOLI|3e-26|30.1|332/350 421: . . + . . .: 480 :GI :Sequence :H :Sec Str