[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:grlA"

grlA        "Glutaredoxin"
            ""

OrgPattern ------------------------11111111------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111221111111111111111111-1111111111111111111111112211111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111---------------------------12---------------------------111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111211111111111111211111111111111111111111111122222222222222111-111111------------------------------------------------- 3311222-93312231222222222222222222222212221222122233221222222221222222341223322322222222-232222232222223221281412222-21-2221222423C2-235111-22222211-122222232233422222222723532435T4444485A62453342233 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLR:Sequence :cccHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHHHTTccEEEEETTTcHHHH:Sec Str : ==========================================================:RP:SCP|3->105|1wikA|1e-17|39.8|103/109|c.47.1.1 :============================================================:BL:SWS|1->104|GLRX2_RICTY|7e-31|56.7|104/111 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->82|PF00462|1e-10|44.4|54/60|Glutaredoxin 61: . . . * . .: 120 :EGIKEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFKK :Sequence :HTTccccccccccEEEETTEEEEEHHHHHHHHTTTcHHHHHTcccccHc :Sec Str :============================================= :RP:SCP|3->105|1wikA|1e-17|39.8|103/109|c.47.1.1 :============================================ :BL:SWS|1->104|GLRX2_RICTY|7e-31|56.7|104/111 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|29->82|PF00462|1e-10|44.4|54/60|Glutaredoxin